DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH9 and CA11

DIOPT Version :9

Sequence 1:NP_651535.1 Gene:CAH9 / 43264 FlyBaseID:FBgn0039486 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_001208.2 Gene:CA11 / 770 HGNCID:1370 Length:328 Species:Homo sapiens


Alignment Length:336 Identity:82/336 - (24%)
Similarity:127/336 - (37%) Gaps:90/336 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLTAFLEASFLLICWSQ-AVSSHVFGYSEPNQRRWARHHGH---------------------CA 43
            |...|.|.|...|:.|:. ..::|:....:|..  |..:..:                     ||
Human     1 MGAAARLSAPRALVLWAALGAAAHIGPAPDPED--WWSYKDNLQGNFVPGPPFWGLVNAAWSLCA 63

  Fly    44 -GKTQSPIAITTSRTTAIHMPAVDMIGYHNLLPYPLKMINNGHTVSITI--------------PK 93
             ||.|||:.:...|           :.|...|| ||::...|..:..|:              |.
Human    64 VGKRQSPVDVELKR-----------VLYDPFLP-PLRLSTGGEKLRGTLYNTGRHVSFLPAPRPV 116

  Fly    94 VNVTEVGEDFLPYIRGAKLPGEFEVEGLHFHWGDKNNRGSEHVINDIRYTMEMHIVHRNKK-YAT 157
            |||:           |..|.....:..|...:|.::..||||.||...::.|:.::|.|:: |..
Human   117 VNVS-----------GGPLLYSHRLSELRLLFGARDGAGSEHQINHQGFSAEVQLIHFNQELYGN 170

  Fly   158 IGEALNHPDGAAVLGFFFNLDEDEGAGL-----------VTINRHLHLIADANQEATLNVTFSLS 211
            ...|...|:|.|:|..|.|:.......|           ::.....:.:.|.:.|.....:|.  
Human   171 FSAASRGPNGLAILSLFVNVASTSNPFLSRLLNRDTITRISYKNDAYFLQDLSLELLFPESFG-- 233

  Fly   212 SLIAGVDVDKFYTYKGSLTTPPCSEAVTWILFPDPIPISPKQISRFRQLSDTQDG----ALVDNF 272
                      |.||:|||:||||||.|||||....:.|:..|:...|.||.....    :|..|.
Human   234 ----------FITYQGSLSTPPCSETVTWILIDRALNITSLQMHSLRLLSQNPPSQIFQSLSGNS 288

  Fly   273 RTLQPVGNRRI 283
            |.|||:.:|.:
Human   289 RPLQPLAHRAL 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH9NP_651535.1 Carb_anhydrase 25..282 CDD:215000 74/308 (24%)
CA11NP_001208.2 alpha_CARP_X_XI_like 48..304 CDD:239395 73/287 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 299..328 0/1 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145661
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.