DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH9 and ca15c

DIOPT Version :9

Sequence 1:NP_651535.1 Gene:CAH9 / 43264 FlyBaseID:FBgn0039486 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_001070801.1 Gene:ca15c / 768190 ZFINID:ZDB-GENE-061013-737 Length:324 Species:Danio rerio


Alignment Length:311 Identity:107/311 - (34%)
Similarity:159/311 - (51%) Gaps:39/311 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LTAFLEASFLLICWS--QAVSSHVFGYSEP--NQRRW---ARHHGHCAGKTQSPIAITTSRTTAI 60
            |.|||.|   |:|.|  ...||..:.|::|  |...|   |.|  ||.|.:||||.|.|::..  
Zfish     5 LLAFLAA---LLCESVHSEGSSVAWCYNDPACNFTTWPELAPH--HCNGSSQSPINIVTAQVQ-- 62

  Fly    61 HMPAVDMIGYHNLLPYPLKMINNGHT-VSITIPKVNVTEVGEDFLPYIRGAKLPGEFEVEGLHFH 124
            ..|        ||..:.|...:...| .|||...|:|....:|.:..::|..|||.:..:..|.|
Zfish    63 ENP--------NLTQFNLTGFDANTTFTSITNAGVSVVVNLDDKIMSVQGGDLPGLYVSKNFHLH 119

  Fly   125 WGDKNN-RGSEHVINDIRYTMEMHIVHRNKKY---ATIGEALNHPDGAAVLGFFF-NLDE-DEGA 183
            ||..:: .||||.:|..:|.||:|||:.:.||   .::..|.:.....||||||. ..|| ::..
Zfish   120 WGSGSSLPGSEHTVNGKQYAMELHIVNVHSKYNGSVSVALAAHDSSALAVLGFFIEGTDEANKTK 184

  Fly   184 GLVTINRHLHLIADANQEATLNV--TFSLSSLIAGVDVDKFYTYKGSLTTPPCSEAVTWILFPDP 246
            |...:...|..|.:.| :.|:::  ..:::||:.|||..|:|.|:||||||.|:|||.|.:|.:|
Zfish   185 GWDVLTSFLTKIPNKN-DTTVDIMNQITMNSLLEGVDKTKYYRYQGSLTTPDCNEAVIWTVFKEP 248

  Fly   247 IPISPKQISRFRQLSDTQDGA----LVDNFRTLQPVGNRRIFARTGHVRHT 293
            |.:|...|:||.....|:..:    :.:|||.:||:..|.:   |..|..|
Zfish   249 IKVSNNLINRFSTTVFTKTTSAPVLIFNNFRGVQPLNGRVV---TSQVEQT 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH9NP_651535.1 Carb_anhydrase 25..282 CDD:215000 93/274 (34%)
ca15cNP_001070801.1 alpha_CA_IV_XV_like 48..291 CDD:239391 86/256 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579085
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR18952
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X57
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
76.810

Return to query results.
Submit another query.