DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH9 and zgc:153760

DIOPT Version :9

Sequence 1:NP_651535.1 Gene:CAH9 / 43264 FlyBaseID:FBgn0039486 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_001070086.1 Gene:zgc:153760 / 767680 ZFINID:ZDB-GENE-060929-528 Length:324 Species:Danio rerio


Alignment Length:331 Identity:103/331 - (31%)
Similarity:149/331 - (45%) Gaps:75/331 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LTAFLEASFL--LICWSQAVSSH----VFGYSEP--NQRRWAR-HHGHCAGKTQSPIAITTSRTT 58
            :.||| .|||  |:|  :.|.|.    .:.|:.|  |...|.. ...:|.|.:||||.|.|::..
Zfish     1 MIAFL-ISFLAALVC--EFVHSDNLPVAWCYNNPACNFPNWPNIAPQYCNGSSQSPIDIVTAQVQ 62

  Fly    59 AIHMPAVDMIGYHNLLPYPL----------KMINNGHTVSITIPKVNVTEVGEDFLPYIRGAKLP 113
                      |..||..:.|          .:.|:|.:|        |..:.||.:. ::|..||
Zfish    63 ----------GNPNLTQFILTGFDANTTFTSITNSGTSV--------VVSLDEDIMS-VQGGDLP 108

  Fly   114 GEFEVEGLHFHWGDKNN-RGSEHVINDIRYTMEMHIVHRNKKY-ATIGEAL--NHPDGAAVLGFF 174
            |.:.....|.|||..:: .||||.::..:|.||:|||:.:..| ..:..||  |.....||||||
Zfish   109 GLYVSVQFHLHWGSSSSLPGSEHTVDGKQYAMELHIVNLHSTYNGNVSAALAANDSSALAVLGFF 173

  Fly   175 F-NLDEDEGAG--------LVTINRHLHLIADANQEATLNVTFSLSSLIAGVDVDKFYTYKGSLT 230
            . ..||.:...        |..|....:...|...:.|:|      ||:.||:..|:|.|:||||
Zfish   174 IEGTDEADKTNSWDVFTSFLSNIPNSGNTYTDIMDQITMN------SLLEGVNKTKYYRYQGSLT 232

  Fly   231 TPPCSEAVTWILFPDPIPISPKQISRF--------RQLSDTQDGALVDNFRTLQPVGNRRIFART 287
            ||||:|.|.|.:|.:||.::...|:||        .:.||..    |:|||.:||:..|.:   |
Zfish   233 TPPCNEDVIWTVFKEPIKVNNNLINRFCTKVFAKTAKASDLN----VNNFRGVQPLNGRVV---T 290

  Fly   288 GHVRHT 293
            ..|..|
Zfish   291 SQVEQT 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH9NP_651535.1 Carb_anhydrase 25..282 CDD:215000 89/290 (31%)
zgc:153760NP_001070086.1 alpha_CA_IV_XV_like 48..291 CDD:239391 85/274 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579088
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR18952
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X57
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
76.810

Return to query results.
Submit another query.