DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH9 and CA8

DIOPT Version :9

Sequence 1:NP_651535.1 Gene:CAH9 / 43264 FlyBaseID:FBgn0039486 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_001308766.1 Gene:CA8 / 767 HGNCID:1382 Length:290 Species:Homo sapiens


Alignment Length:274 Identity:90/274 - (32%)
Similarity:139/274 - (50%) Gaps:28/274 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 FGYSEPNQRRWARHHGHCAGKTQSPIAITTSRTTAIHMPAVDM-IGYHNLLPYPLKMINNGHTVS 88
            :||.|..:  |........|:.||||.: .||........:|: :..:.::....::.|:|||:.
Human    29 WGYEEGVE--WGLVFPDANGEYQSPINL-NSREARYDPSLLDVRLSPNYVVCRDCEVTNDGHTIQ 90

  Fly    89 ITIPKVNVTEVGEDFLPYIRGAKLP--GEFEVEGLHFHWGDKNNRGSEHVINDIRYTMEMHIVHR 151
            :.:...:|          :.|..||  .|||:..:.||||.:|.|||||.:|...:.||:|::|.
Human    91 VILKSKSV----------LSGGPLPQGHEFELYEVRFHWGRENQRGSEHTVNFKAFPMELHLIHW 145

  Fly   152 NKK-YATIGEALNHPDGAAVLGFFFNLDEDEGAGLVTINRHLHLIADANQEATLNVTFSLSSLIA 215
            |.. :.:|.||:..|.|.|::..|..:.: |..||..:...|..|....:..|: ..|:.::|:.
Human   146 NSTLFGSIDEAVGKPHGIAIIALFVQIGK-EHVGLKAVTEILQDIQYKGKSKTI-PCFNPNTLLP 208

  Fly   216 GVDVDKFYTYKGSLTTPPCSEAVTWILFPDPIPISPKQISRFR---------QLSDTQDGALVDN 271
            ...:..::.|:||||.|||||.||||||..|:.||..||..||         :|.:..||.|.||
Human   209 DPLLRDYWVYEGSLTIPPCSEGVTWILFRYPLTISQLQIEEFRRLRTHVKGAELVEGCDGILGDN 273

  Fly   272 FRTLQPVGNRRIFA 285
            ||..||:.:|.|.|
Human   274 FRPTQPLSDRVIRA 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH9NP_651535.1 Carb_anhydrase 25..282 CDD:215000 87/269 (32%)
CA8NP_001308766.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..26
alpha_CARP_VIII 35..289 CDD:239394 87/268 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145696
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X57
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.