DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH9 and CA5A

DIOPT Version :9

Sequence 1:NP_651535.1 Gene:CAH9 / 43264 FlyBaseID:FBgn0039486 Length:311 Species:Drosophila melanogaster
Sequence 2:XP_011521611.1 Gene:CA5A / 763 HGNCID:1377 Length:376 Species:Homo sapiens


Alignment Length:220 Identity:58/220 - (26%)
Similarity:92/220 - (41%) Gaps:49/220 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 KLTAFLEASFLL-----ICWSQAVSSHVFGYSEPNQRRWARHHGHCAGKTQS---------PIAI 52
            |.:||   |||:     ..||:::        .|.  ||..... ||.:|.:         |:::
Human     8 KTSAF---SFLVEQMWAPLWSRSM--------RPG--RWCSQRS-CAWQTSNNTLHPLWTVPVSV 58

  Fly    53 T-TSRTTAIHMPAVDMIGYHNLLPYP--------LKMINNGHTVSITIPKVNVTEVGEDFLPYIR 108
            . .:|.:.|::...|.:....|.|..        |.:.|.|:...:...  :.||...     |.
Human    59 PGGTRQSPINIQWRDSVYDPQLKPLRVSYEAASCLYIWNTGYLFQVEFD--DATEASG-----IS 116

  Fly   109 GAKLPGEFEVEGLHFHWGDKNNRGSEHVINDIRYTMEMHIVHRNK-KYATIGEALNHPDGAAVLG 172
            |..|...:.::..|||||..|..||||.::...|..|:|:||.|. ||....||:...:|.||:|
Human   117 GGPLENHYRLKQFHFHWGAVNEGGSEHTVDGHAYPAELHLVHWNSVKYQNYKEAVVGENGLAVIG 181

  Fly   173 FFFNLDEDEGAGLVTINRHLHLIAD 197
            .|..|    ||...|:.|.:.::.:
Human   182 VFLKL----GAHHQTLQRLVDILPE 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH9NP_651535.1 Carb_anhydrase 25..282 CDD:215000 50/192 (26%)
CA5AXP_011521611.1 alpha_CA 61..>212 CDD:294017 43/153 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145706
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X57
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.