DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH9 and ca5b

DIOPT Version :9

Sequence 1:NP_651535.1 Gene:CAH9 / 43264 FlyBaseID:FBgn0039486 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_001039155.1 Gene:ca5b / 733981 XenbaseID:XB-GENE-1003819 Length:319 Species:Xenopus tropicalis


Alignment Length:266 Identity:84/266 - (31%)
Similarity:121/266 - (45%) Gaps:60/266 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 GKTQSPIAITTSRTTAIHMPAVDMIGYHNLLPYP--------LKMINNGHTVSITIPKVNVTEVG 100
            |..||||.|...          |.:.:..|.|..        |.:.|||::.             
 Frog    63 GSRQSPINIRIR----------DSVFHPQLAPVHTQYDPNTCLYIWNNGYSF------------- 104

  Fly   101 EDFLPY--------IRGAKLPGEFEVEGLHFHWGDKNNRGSEHVINDIRYTMEMHIVHRN-KKYA 156
              |:.|        :.|..|...|.::..|||||..|:.||||.::...:..|:|:||.| .||.
 Frog   105 --FVEYDDSTDKSTVSGGPLENPFRLKQFHFHWGRNNDWGSEHTVDSRVFPAELHLVHWNCSKYR 167

  Fly   157 TIGEALNHPDGAAVLGFFFNLDE--DEGAGLVTI---NRHLHLIADANQEATLNVTFSLSSLIAG 216
            |..||:..|:|.||:|.|..:.:  ::...||.|   .|:...:.:.|.       |..|.|:. 
 Frog   168 TFEEAIMEPNGLAVIGVFLKVGKHHEKLQKLVDILPSVRYKDALTEFNY-------FDSSCLLP- 224

  Fly   217 VDVDKFYTYKGSLTTPPCSEAVTWILFPDPIPISPKQISRFRQLSDTQDGA----LVDNFRTLQP 277
             ....::||.|||||||.:|:||||:...||.:...|::.||.|..|..|.    :|||||.|||
 Frog   225 -SCGDYWTYSGSLTTPPLTESVTWIIMKKPIEVDHSQLAVFRSLLFTAVGEEERYMVDNFRPLQP 288

  Fly   278 VGNRRI 283
            :.||.:
 Frog   289 LMNRTV 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH9NP_651535.1 Carb_anhydrase 25..282 CDD:215000 83/263 (32%)
ca5bNP_001039155.1 alpha_CA_V 63..298 CDD:239392 84/266 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X57
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.