DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH9 and PTPRG

DIOPT Version :9

Sequence 1:NP_651535.1 Gene:CAH9 / 43264 FlyBaseID:FBgn0039486 Length:311 Species:Drosophila melanogaster
Sequence 2:XP_016862450.1 Gene:PTPRG / 5793 HGNCID:9671 Length:1485 Species:Homo sapiens


Alignment Length:299 Identity:83/299 - (27%)
Similarity:127/299 - (42%) Gaps:66/299 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 WARHHGHCAGKTQSPIAITTS-RTTAIHMPAVDMIGYHNLLPYPLKMINNGHTVSITIPKVNVTE 98
            |......|.|:.||||.|... .........:.:.|:.|.......|.|.|.||:|.:.      
Human    71 WVTSSVSCGGRHQSPIDILDQYARVGEEYQELQLDGFDNESSNKTWMKNTGKTVAILLK------ 129

  Fly    99 VGEDFLPYIRGAKLPGEFEVEGLHFHWGDKN-NRGSEHVINDIRYTME---------MHIVHRNK 153
              :|:  ::.||.|||.|:.|.:.||||..| :.||||.||..|:.:|         |.::.:..
Human   130 --DDY--FVSGAGLPGRFKAEKVEFHWGHSNGSAGSEHSINGRRFPVEAEDARGGDIMLMLSQGM 190

  Fly   154 KYATIG---------------EALN----HPD---------------GAAVLGFFFNLDEDEGAG 184
            ::..:|               :::.    :||               ||  :..||.:...:.:.
Human   191 RFILLGLKKEQFEERKSWTTYQSMQIFFYNPDDFDSFQTAISENRIIGA--MAIFFQVSPRDNSA 253

  Fly   185 LVTINRHLHLIADANQEATLNVTFSLSSLIAGVDVDKFYTYKGSLTTPPCSEAVTWILFPDPIPI 249
            |..|...|..:....:|..|: .|.|..|:. ..:..:|.|.||||||||||.|.||:|..|:||
Human   254 LDPIIHGLKGVVHHEKETFLD-PFVLRDLLP-ASLGSYYRYTGSLTTPPCSEIVEWIVFRRPVPI 316

  Fly   250 SPKQISRFRQL--SDTQDGA-----LVDNFRTLQPVGNR 281
            |..|:..|..:  ::.||..     |.:|||..|.:.:|
Human   317 SYHQLEAFYSIFTTEQQDHVKSVEYLRNNFRPQQRLHDR 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH9NP_651535.1 Carb_anhydrase 25..282 CDD:215000 83/299 (28%)
PTPRGXP_016862450.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.