DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH9 and ca5a

DIOPT Version :9

Sequence 1:NP_651535.1 Gene:CAH9 / 43264 FlyBaseID:FBgn0039486 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_001104671.1 Gene:ca5a / 569989 ZFINID:ZDB-GENE-080220-57 Length:310 Species:Danio rerio


Alignment Length:279 Identity:85/279 - (30%)
Similarity:128/279 - (45%) Gaps:56/279 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 GKTQSPIAITTSRTTAIHMPAVDMIGYHNLLPYPLK----------MINNGHTVSITIPKVNVTE 98
            |..||||.|...:  :|..|.:          .|||          :.|||:  |..:...:.|:
Zfish    62 GDRQSPIDIEVRK--SIFNPQL----------RPLKVQYDPRTCQQIWNNGY--SFLVEYDDTTD 112

  Fly    99 VGEDFLPYIRGAKLPGEFEVEGLHFHWGDKNNRGSEHVINDIRYTMEMHIVHRNK-KYATIGEAL 162
            ...     ::|..|..::.:...|||||:.||.||||.|:...|..|:||||.|. ||:...||:
Zfish   113 KST-----VKGGPLENQYRLCQFHFHWGENNNWGSEHSIDRRLYAAELHIVHWNSDKYSLFEEAV 172

  Fly   163 NHPDGAAVLGFFFNLDE-DEG----AGLVTINRHLHLIADANQEATLNVTFSLSSLIAGVDVDKF 222
            ...:|.||:|.|..:.: .||    ...:...||...:.:.|:       |..|.|:. .::..:
Zfish   173 MEENGLAVIGVFLKVGKRHEGLQKLVDALPAVRHKDSVVEFNK-------FDPSCLLP-ENISDY 229

  Fly   223 YTYKGSLTTPPCSEAVTWILFPDPIPISPKQISRFRQLSDTQ-----DGALVDNFRTLQPVGNRR 282
            :||.|||||||.:||||||:....|.:|..|::.||.|..|.     ..::|:|||..|.:..|.
Zfish   230 WTYPGSLTTPPLTEAVTWIVMKQHIEVSHDQLAVFRSLLFTSAEEQVQRSMVNNFRVQQDLKGRA 294

  Fly   283 IFARTGHVRHTSIATLKHE 301
            :        |:|.:....|
Zfish   295 V--------HSSFSPFLKE 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH9NP_651535.1 Carb_anhydrase 25..282 CDD:215000 81/258 (31%)
ca5aNP_001104671.1 alpha_CA 62..299 CDD:294017 83/271 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579064
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X57
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.