DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH9 and ca10b

DIOPT Version :9

Sequence 1:NP_651535.1 Gene:CAH9 / 43264 FlyBaseID:FBgn0039486 Length:311 Species:Drosophila melanogaster
Sequence 2:XP_005164153.1 Gene:ca10b / 568543 ZFINID:ZDB-GENE-080815-2 Length:326 Species:Danio rerio


Alignment Length:267 Identity:82/267 - (30%)
Similarity:125/267 - (46%) Gaps:54/267 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 CA-GKTQSPIAITTSRTTAIHMPAVDMIGYHNLLPYPLK-----------MINNGHTVSITIPKV 94
            || ||.|||:.|.|||  .|..|.::          ||:           |.|.|..||:...|.
Zfish    59 CAIGKRQSPVNIETSR--MIFDPFLN----------PLRLNAGQRKVSGTMYNTGRHVSLRPDKS 111

  Fly    95 NVTEVGEDFLPYIRGAKLPGEFEVEGLHFHWGDKNNRGSEHVINDIRYTMEMHIVHRNKK-YATI 158
            ::..        |.|..|...:.:|.:..|:|.::||||||::|...:..|:.::|.|:. |...
Zfish   112 HLVN--------ISGGPLSYSYRLEEIRLHFGSEDNRGSEHLLNGQAFPGEVQLIHYNQDLYLNY 168

  Fly   159 GEALNHPDGAAVLGFFFNLDEDEGAGLVTINRHLHLIADANQEATLNVTFSLSS-LIAGVDVDKF 222
            .:|:..|:|.||:..|..:.|...   |.:||.|      |:|....:|:...: |:.|:::::.
Zfish   169 SDAVRSPNGIAVVSIFMKISEPTN---VFLNRML------NRETVTRITYKHDAYLLMGLNIEEL 224

  Fly   223 Y-------TYKGSLTTPPCSEAVTWILFPDPIPISPKQISRFRQLSDTQDG----ALVDNFRTLQ 276
            |       ||:||:|.|||.|..||||...||.||..::...|.||..|..    ::.||.|..|
Zfish   225 YPETSRFITYEGSITIPPCLETATWILMNKPIYISQIEMQSLRLLSQNQPSQIFLSMGDNMRPTQ 289

  Fly   277 PVGNRRI 283
            .:..|.|
Zfish   290 TLHQRCI 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH9NP_651535.1 Carb_anhydrase 25..282 CDD:215000 80/264 (30%)
ca10bXP_005164153.1 PLN02179 7..257 CDD:177835 69/226 (31%)
alpha_CARP_X_XI_like 45..301 CDD:239395 82/267 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.