DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH9 and car15

DIOPT Version :9

Sequence 1:NP_651535.1 Gene:CAH9 / 43264 FlyBaseID:FBgn0039486 Length:311 Species:Drosophila melanogaster
Sequence 2:XP_005169278.1 Gene:car15 / 568143 ZFINID:ZDB-GENE-091204-152 Length:312 Species:Danio rerio


Alignment Length:212 Identity:72/212 - (33%)
Similarity:111/212 - (52%) Gaps:17/212 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 MINNGHTVSITIPKVNVTEVGEDFLPYIRGAKLPGEFEVEGLHFHWGDKNNRGSEHVINDIRYTM 144
            :.|.||:|        |.|||:..  .:.|..||..:....||||||..::.||||.::.:|:.|
Zfish    82 LTNQGHSV--------VLEVGDGM--QVSGGGLPATYRTFQLHFHWGSVSSNGSEHTLDHLRFPM 136

  Fly   145 EMHIVHRNKKYATIGEALNHPDGAAVLGFFFNLDEDEGAGLVTINRHLHLIADANQEATLNVTFS 209
            |||||:....:..:..||..|.|.||||.|.::.........:|:..|..:|...|..::. .|.
Zfish   137 EMHIVNIKSTHPNLTSALEDPTGIAVLGVFVDVTYLHNENFQSISSALSYVAYKGQTKSIK-PFP 200

  Fly   210 LSSLIAGVDVDKFYTYKGSLTTPPCSEAVTWILFPDPIPISPKQISRF-RQLSDTQDGA-----L 268
            |.:|:...::.::|.|.||||||||||.|.|.::..|:.||..|..:| ..:..|::.|     |
Zfish   201 LVNLLPQNNLTQYYRYHGSLTTPPCSEVVLWTIYEVPVYISWAQFEQFVSGIYSTEEEAEIQALL 265

  Fly   269 VDNFRTLQPVGNRRIFA 285
            .||:|.:.|..:|.::|
Zfish   266 HDNYRHIHPTYSRPVYA 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH9NP_651535.1 Carb_anhydrase 25..282 CDD:215000 70/207 (34%)
car15XP_005169278.1 alpha_CA_IV_XV_like 46..282 CDD:239391 71/210 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR18952
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X57
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
98.880

Return to query results.
Submit another query.