DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH9 and ca9

DIOPT Version :9

Sequence 1:NP_651535.1 Gene:CAH9 / 43264 FlyBaseID:FBgn0039486 Length:311 Species:Drosophila melanogaster
Sequence 2:XP_009303384.1 Gene:ca9 / 566612 ZFINID:ZDB-GENE-080818-5 Length:384 Species:Danio rerio


Alignment Length:288 Identity:98/288 - (34%)
Similarity:144/288 - (50%) Gaps:43/288 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 SSHVFGYSEPNQRRWARHHGHCAGKTQSPIAITTSRTTAIH---MPAVDMIGYHNLLPYPLKMIN 82
            |||...:...:|..|.....||.||:||||.|.|.:  .:|   :|.:.:.||.....:.|.::|
Zfish    38 SSHQHHWGYQDQDAWLSAFEHCGGKSQSPINIDTHK--VLHEPRLPPIQLDGYDLTGSHSLTLLN 100

  Fly    83 NGHTVSITIPKVNVTEVGEDFLPYIRGAKLPGEFEVEGLHFHWGDKNNRGSEHVINDIRYTMEMH 147
            ||||:.:::|.......|.|.: |:...          ||||||.....||||.|::|.|..|:|
Zfish   101 NGHTLQLSLPSSMRIRRGFDQV-YVAAQ----------LHFHWGTTEVPGSEHTIDNIHYPAEIH 154

  Fly   148 IVHRNKKYATIGEALNHPDGAAVLGFFFNLDEDEGAGLVTINRH--------LHLIADANQEATL 204
            :||.|.|||.:.||.:..||.||||           |.:.|..|        |..::|.:.|.:|
Zfish   155 VVHYNSKYANLTEAASKADGLAVLG-----------GFIAIGLHENDNYEKILSALSDVSTEESL 208

  Fly   205 NVT--FSLSSLIAGVDVDKFYTYKGSLTTPPCSEAVTWILFPDPIPISPKQISRFRQLSDTQDGA 267
            .|.  |::..|:.. .:::||.|.||||||||.:.|:|.||.|.|.:|.:|::...:...|:...
Zfish   209 TVIPGFNVRHLLPN-SLERFYRYSGSLTTPPCLQTVSWTLFNDSIRVSRRQLAALEESLKTEHNK 272

  Fly   268 LVD-NFRTLQPVGNRRIFARTGHVRHTS 294
            |:. |||..|.:..|:|.:..    |||
Zfish   273 LLSKNFRAPQLLHGRKIQSSF----HTS 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH9NP_651535.1 Carb_anhydrase 25..282 CDD:215000 90/270 (33%)
ca9XP_009303384.1 alpha_CA_IX 48..294 CDD:239403 92/274 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 157 1.000 Domainoid score I4112
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100138
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X57
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.820

Return to query results.
Submit another query.