DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH9 and ca12

DIOPT Version :9

Sequence 1:NP_651535.1 Gene:CAH9 / 43264 FlyBaseID:FBgn0039486 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_001016431.1 Gene:ca12 / 549185 XenbaseID:XB-GENE-1015246 Length:335 Species:Xenopus tropicalis


Alignment Length:317 Identity:95/317 - (29%)
Similarity:143/317 - (45%) Gaps:76/317 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 QAVS-SHVFGY-SEPNQRRWARHHGHCAGKTQSPIAITTSRTTAIHMPAVDMIGYHNLLPYPLK- 79
            ||.| .|.:.| ....::.|.:::..|.|..||||        .||.   |::.|.:.| .|:| 
 Frog    15 QAASEGHGWAYIGTKGEKSWPKNYEFCGGVYQSPI--------DIHQ---DILQYDSSL-QPVKL 67

  Fly    80 ------------MINNGHTVSITIPKVNVTEVGEDFLPYIRGAKLPGEFEVEGLHFHWGDK-NNR 131
                        :.||||||.:::            :|.::....|..:....||.|||.: ..:
 Frog    68 NGYNVSPAESFTLSNNGHTVQMSL------------VPTMQIKIAPFHYTASQLHLHWGQRGTQK 120

  Fly   132 GSEHVINDIRYTMEMHIVHRNK-KYATIGEALNHPDGAAVLGFF-----FNLDEDEGAGLVTINR 190
            ||||.|...|:..|:|:|:.|. ||:.|..|:...||.||||..     ||...::      |..
 Frog   121 GSEHCIEGKRFAGEVHLVNYNSDKYSDITTAMKESDGLAVLGILLEVGPFNPTFEK------IIS 179

  Fly   191 HLHLIADANQEATLNVTFSLSSLIAGVDV--------DKFYTYKGSLTTPPCSEAVTWILFPDPI 247
            .||.|...:|          |..|||.:|        |::|.|:||||||||..:|.|.:|.:|:
 Frog   180 QLHSIGYKDQ----------SVQIAGFNVQELLPKRLDEYYRYEGSLTTPPCYPSVLWTVFRNPV 234

  Fly   248 PISPKQISRFRQL---SDTQDGA-LVDNFRTLQPVGNRRIFA--RTGHVRHTSIATL 298
            .||.:|:......   :|..:.. :.:|:|.|||.|:|.:..  |.|.|...::|.|
 Frog   235 TISEEQLITLETALYSTDRNESVQMTNNYRQLQPHGDRLVSVSFREGVVLTIALACL 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH9NP_651535.1 Carb_anhydrase 25..282 CDD:215000 85/289 (29%)
ca12NP_001016431.1 alpha_CA_XII_XIV 30..278 CDD:239400 85/287 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X57
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.