DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH9 and ca7

DIOPT Version :9

Sequence 1:NP_651535.1 Gene:CAH9 / 43264 FlyBaseID:FBgn0039486 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_001015903.1 Gene:ca7 / 548657 XenbaseID:XB-GENE-1017206 Length:266 Species:Xenopus tropicalis


Alignment Length:284 Identity:90/284 - (31%)
Similarity:144/284 - (50%) Gaps:47/284 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 HVFGYSE---PNQRRWARHHGHCAGKTQSPIAITTSRTTAIHMPAVD--MIGYHNLLPYPLKMIN 82
            |.:||.|   |::  |..:.....|..||||.|.:::  |:..|:::  :|.|.:..  .:.:.|
 Frog     5 HCWGYGEEDGPSE--WHHYFPIAEGNRQSPIDIVSNQ--AVFNPSLNPLVISYDHCT--SINLSN 63

  Fly    83 NGHTVSITIPKVNVTEVGEDFLPYIRGAKLPGEFEVEGLHFHWGDKNNRGSEHVINDIRYTMEMH 147
            |||:|.:.....:...|       |.|..|.|.:.::..|||||.:.|.||||.::...|..|:|
 Frog    64 NGHSVMVEFDDYDDKTV-------ITGGPLEGSYRLKQFHFHWGTQRNSGSEHTVDGKSYPCELH 121

  Fly   148 IVHRN-KKYATIGEALNHPDGAAVLGFFFNLDEDEGAGLVTINRHLHLIA---------DANQEA 202
            :||.| :.|::.|||...|||..|:|.|.... .:.:||..:...|:::.         |.|.:.
 Frog   122 LVHWNARAYSSFGEAAAAPDGLVVIGVFLETG-GQHSGLNRLTDALYMVKFKGTKTQFDDFNPKC 185

  Fly   203 TLNVTFSLSSLIAGVDVDKFYTYKGSLTTPPCSEAVTWILFPDPIPISPKQISRFRQL------S 261
            .|..:|            :::||.|||||||.:|:||||:..:||.:|.||:.|||:.      .
 Frog   186 LLPSSF------------EYWTYPGSLTTPPLNESVTWIVLKEPIKVSEKQMERFRKTLLFSGEE 238

  Fly   262 DTQDGALVDNFRTLQPVGNRRIFA 285
            :.|...:|:|||..||:..|::.|
 Frog   239 EEQRIHMVNNFRPPQPLKGRKVQA 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH9NP_651535.1 Carb_anhydrase 25..282 CDD:215000 87/277 (31%)
ca7NP_001015903.1 alpha_CA_VII 27..264 CDD:239402 84/260 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X57
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.