DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH9 and ca8

DIOPT Version :9

Sequence 1:NP_651535.1 Gene:CAH9 / 43264 FlyBaseID:FBgn0039486 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_001011213.1 Gene:ca8 / 496646 XenbaseID:XB-GENE-953676 Length:282 Species:Xenopus tropicalis


Alignment Length:278 Identity:92/278 - (33%)
Similarity:141/278 - (50%) Gaps:36/278 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 FGYSEPNQRRWARHHGHCAGKTQSPIAITTSRTTAIHMPAVDMIGYHNLLP-YPL----KMINNG 84
            :||.|..:  |...:....|..||||.|.:..  |::.|::..:   .|.| |.:    ::||:|
 Frog    21 WGYEEGVE--WGLLYPEANGDYQSPININSRE--AMYDPSLLEV---RLTPSYVVCRDCEVINDG 78

  Fly    85 HTVSITIPKVNVTEVGEDFLPYIRGAKLP--GEFEVEGLHFHWGDKNNRGSEHVINDIRYTMEMH 147
            |.|.|.:...:|          ::|..||  .|:|:..:.||||.:|.|||||.:|...:.||:|
 Frog    79 HVVQILLKSKSV----------LKGGPLPRGHEYELNEVRFHWGKENQRGSEHTVNFKAFPMELH 133

  Fly   148 IVHRNKK-YATIGEALNHPDGAAVLGFFFNLDEDEGAGLVTINRHLHLIADANQEATLNVTFSLS 211
            ::|.|.. |.::.||:....|..::..|..:.: |..||..|...|..|....:..|: ..|:.:
 Frog   134 LIHWNSTLYRSLEEAMGKVHGIVIISLFVQIGK-ENIGLKAITEVLQDIFYKGKSKTI-PCFNPN 196

  Fly   212 SLIAGVDVDKFYTYKGSLTTPPCSEAVTWILFPDPIPISPKQISRFRQ---------LSDTQDGA 267
            :|:....:..::.|:||||.|||||.||||||..|:.:|..||..||:         |.|..||.
 Frog   197 TLLPDPLLRDYWVYEGSLTMPPCSEGVTWILFRYPLTVSQTQIEEFRRLRTHIKGADLPDGCDGL 261

  Fly   268 LVDNFRTLQPVGNRRIFA 285
            :.||||..||:.:|.|.|
 Frog   262 MADNFRPTQPLSDRIIRA 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH9NP_651535.1 Carb_anhydrase 25..282 CDD:215000 89/273 (33%)
ca8NP_001011213.1 alpha_CARP_VIII 26..281 CDD:239394 89/273 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X57
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.