DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH9 and CAH2

DIOPT Version :9

Sequence 1:NP_651535.1 Gene:CAH9 / 43264 FlyBaseID:FBgn0039486 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_648555.1 Gene:CAH2 / 39390 FlyBaseID:FBgn0027843 Length:335 Species:Drosophila melanogaster


Alignment Length:278 Identity:97/278 - (34%)
Similarity:143/278 - (51%) Gaps:15/278 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LLICWSQAVSSHVFGY-SEPNQRRWARHHGHCAGKTQSPIAITTSRTTAIHMPAVDMIGYHNLLP 75
            :||| :..|.:..||| .......|:..:..|:||.||||.|..........|.::...: .::|
  Fly    16 ILIC-ASLVLAQDFGYEGRHGPEHWSEDYARCSGKHQSPINIDQVSAVEKKFPKLEFFNF-KVVP 78

  Fly    76 YPLKMINNGHTVSITIPKVNVTEVGEDFLPYIRGA----KLPGEFEVEGLHFHWGDKNNRGSEHV 136
            ..|:|.||||||.:.:      ...||.:|.:||.    |.|..::.|..|||||:.:..|||.:
  Fly    79 DNLQMTNNGHTVLVKM------SYNEDEIPSVRGGPLAEKTPLGYQFEQFHFHWGENDTIGSEDL 137

  Fly   137 INDIRYTMEMHIVHRNKKYATIGEALNHPDGAAVLGFFFNLDEDEGAGLVTINRHLHLIADANQE 201
            ||:..|..|:|:|.||.:|.....||:...|.||:.|||.:.:....|.......|..|....:.
  Fly   138 INNRAYPAELHVVLRNLEYPDFASALDKDHGIAVMAFFFQVGDKSTGGYEGFTNLLSQIDRKGKS 202

  Fly   202 ATLNVTFSLSSLIAGVDVDKFYTYKGSLTTPPCSEAVTWILFPDPIPISPKQISRFRQLSDTQDG 266
            ..:.....|...|: ..|:.:::|.||||||||||.||||.|..||.|:.||::.||.|: ..|.
  Fly   203 VNMTNPLPLGEYIS-KSVESYFSYTGSLTTPPCSEEVTWIDFTTPIDITEKQLNAFRLLT-ANDD 265

  Fly   267 ALVDNFRTLQPVGNRRIF 284
            .|.:|||.:||:.:|.::
  Fly   266 HLKNNFRPIQPLNDRTLY 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH9NP_651535.1 Carb_anhydrase 25..282 CDD:215000 92/261 (35%)
CAH2NP_648555.1 Carb_anhydrase 28..281 CDD:215000 92/261 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 91 1.000 Domainoid score I2610
eggNOG 1 0.900 - - E1_COG3338
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I2251
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG27166
OrthoDB 1 1.010 - - D113047at6656
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 1 1.000 - - mtm1014
orthoMCL 1 0.900 - - OOG6_100138
Panther 1 1.100 - - P PTHR18952
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X57
1110.880

Return to query results.
Submit another query.