DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH9 and CAH3

DIOPT Version :9

Sequence 1:NP_651535.1 Gene:CAH9 / 43264 FlyBaseID:FBgn0039486 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_001259349.1 Gene:CAH3 / 31804 FlyBaseID:FBgn0030056 Length:250 Species:Drosophila melanogaster


Alignment Length:255 Identity:85/255 - (33%)
Similarity:121/255 - (47%) Gaps:36/255 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 QSPIAITTSRTTAIHMPAVDMIGYHNLLPYPLKMINNGHTVSITIPKVN-------VTEVGEDFL 104
            ||||.|  |.....|:..||.:.||            ||...:.:.:|.       ||.......
  Fly     4 QSPIEI--SNRAIEHIDDVDPLEYH------------GHWEPVGVARVQNTGTSAMVTFSKRKQQ 54

  Fly   105 PYIRGAKLPGEFEV-EGLHFHWGDKNNRGSEHVINDIRYTMEMHIVHRNKKYATIGEALNHPDGA 168
            |||.|..|..:..| |.|||||.|.:..|.||.:..::|:||.|.||.|.||....||.|.|||.
  Fly    55 PYIIGGALEQDMYVFEQLHFHWSDCDESGCEHTLEGMKYSMEAHAVHYNSKYKDFTEAKNKPDGL 119

  Fly   169 AVLGFFFN-LDEDEGAGLVTINRHLHLIADANQEATLNVTFSLSSLIAGVDVDK----FYTYKGS 228
            ||:.||.. ..|.:......|...:.::...:..|:|:     |..::.:.:.:    :||||||
  Fly   120 AVVAFFIQACGEKDCPEFKKITEGIRIVQKIHTSASLD-----SDCLSWIGLQELSKHYYTYKGS 179

  Fly   229 LTTPPCSEAVTWILFPDPIPISPKQISRFRQLSD---TQDGALVDNFRTLQ-PVGNRRIF 284
            |||.|..|:||||::..||.:|..|:..||.|..   .:...:|:|:|.:| |..:..||
  Fly   180 LTTAPYFESVTWIIYRTPIYVSRGQVQVFRNLQSCPKDESKKIVNNYREIQRPHKDPEIF 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH9NP_651535.1 Carb_anhydrase 25..282 CDD:215000 83/251 (33%)
CAH3NP_001259349.1 alpha_CA 4..233 CDD:238200 82/247 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 91 1.000 Domainoid score I2610
eggNOG 1 0.900 - - E1_COG3338
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I2251
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 1 1.000 - - mtm1014
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR18952
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.970

Return to query results.
Submit another query.