DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH9 and CARPA

DIOPT Version :9

Sequence 1:NP_651535.1 Gene:CAH9 / 43264 FlyBaseID:FBgn0039486 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_001284986.1 Gene:CARPA / 31687 FlyBaseID:FBgn0029962 Length:333 Species:Drosophila melanogaster


Alignment Length:341 Identity:85/341 - (24%)
Similarity:140/341 - (41%) Gaps:80/341 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 ASFLLICWSQAVSS-----HVFGYSEPN-----QRRWARHHGHC-AGKTQSPIAITTSRTTAIHM 62
            ::.:|:|.|:.:||     ...|.|.|:     ..:|    ..| .|:.||||.:...:      
  Fly    21 SAIVLLCSSEVLSSWEEWWTYDGISGPSFWGLINPQW----NMCNKGRRQSPIDVVPDK------ 75

  Fly    63 PAVDMIGYHNLL--PYPLKMINNGHTVSITIPKVN---VTEVGEDFLPY--IRGAKLPGEFEVEG 120
                      ||  ||...:..:.|.||.|:....   |..|.:|...:  |.|..|...::.|.
  Fly    76 ----------LLFDPYLRPLHIDKHKVSGTLHNTGQSLVFRVDKDTKQHVNISGGPLAYRYQFEE 130

  Fly   121 LHFHWGDKNNRGSEHVINDIRYTMEMHIVHRNKK-YATIGEALNHPDGAAVLGFFFNLDEDEGAG 184
            ::.|:|.:|.|||||.|....:..|:.|...||: |..:.||.:...|...|.....:.|     
  Fly   131 IYIHYGTENVRGSEHFIQGYSFPGEIQIYGFNKELYHNMSEAQHKSQGIVGLSLMVQIGE----- 190

  Fly   185 LVTINRHLHLIADANQEATLNVT-----------FSLSSLIAGVDVDKFYTYKGSLTTPPCSEAV 238
              |.|..|.:|.     :|.|..           .|:.||:.  :.|.:.||:||.|.|.|.|:.
  Fly   191 --TPNPELRIIT-----STFNKVLYRGFSTPIRHISVRSLLP--NTDHYITYEGSTTHPGCWEST 246

  Fly   239 TWILFPDPIPISPKQISRFRQL----SDTQDGALVDNFRTLQPVGNRRIFARTGHVRHTSIATLK 299
            .||:...||.|:.:::.:.|:|    ..|....|.:|.|.:|.:.:|.:        .|:|...:
  Fly   247 VWIIVNKPIYITKQELYQLRRLMQGSESTPKAPLGNNARPVQSLHHRTV--------RTNIDFKR 303

  Fly   300 HEGEY----LKYDWFY 311
            ::.:|    :..|.:|
  Fly   304 NKNQYACPSMYKDMYY 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH9NP_651535.1 Carb_anhydrase 25..282 CDD:215000 74/285 (26%)
CARPANP_001284986.1 alpha_CARP_X_XI_like 46..300 CDD:239395 74/295 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 91 1.000 Domainoid score I2610
eggNOG 1 0.900 - - E1_COG3338
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I2251
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR18952
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.970

Return to query results.
Submit another query.