DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH9 and Ca9

DIOPT Version :9

Sequence 1:NP_651535.1 Gene:CAH9 / 43264 FlyBaseID:FBgn0039486 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_001101426.1 Gene:Ca9 / 313495 RGDID:1306426 Length:437 Species:Rattus norvegicus


Alignment Length:258 Identity:88/258 - (34%)
Similarity:132/258 - (51%) Gaps:25/258 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 WARHHGHCAGKTQSPIAITTSRTTAIH-MPAVDMIGYH-NLLPYPLKMINNGHTVSITIPKVNVT 97
            |.:....|||:.|||:.|....|:... :..::::||. ..|| .|.:.||||||.:|:|     
  Rat   128 WPQVSPACAGRFQSPVDIRLELTSFCRTLQPLELLGYELQSLP-ELSLCNNGHTVQLTLP----- 186

  Fly    98 EVGEDFLPYIRGAKLPG-EFEVEGLHFHWGDKNNRGSEHVINDIRYTMEMHIVHRNKKYATIGEA 161
                   |.::....|| |:....||.|||..::.||||.:|..|:..|:|:||.:..::.:.||
  Rat   187 -------PGLKMVLGPGQEYRALQLHLHWGTSDHPGSEHTVNGHRFPAEIHVVHLSTAFSELHEA 244

  Fly   162 LNHPDGAAVLGFFFNLDEDEGAGLVTINRHLHLIADANQEAT---LNVTFSLSSLIAGVDVDKFY 223
            |..|.|.|||..|.....:|.:....:..||..||:...:..   |:|:..|.|     |:.::|
  Rat   245 LGRPGGLAVLAAFLQESPEENSAYEQLLSHLEEIAEEGSKIEIPGLDVSALLPS-----DLSRYY 304

  Fly   224 TYKGSLTTPPCSEAVTWILFPDPIPISPKQISRFR-QLSDTQDGALVDNFRTLQPVGNRRIFA 285
            .|:|||||||||:.|.|.:|.:.:.:|.||:.... .|...:|..|..|||..||:..|.|.|
  Rat   305 RYEGSLTTPPCSQGVIWTVFNETVKLSAKQLHTLSVSLWGLRDSRLQLNFRATQPLNGRTIEA 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH9NP_651535.1 Carb_anhydrase 25..282 CDD:215000 85/253 (34%)
Ca9NP_001101426.1 alpha_CA 128..370 CDD:294017 88/258 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339399
Domainoid 1 1.000 146 1.000 Domainoid score I4412
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 146 1.000 Inparanoid score I4322
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100138
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X57
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.700

Return to query results.
Submit another query.