DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH9 and Ca11

DIOPT Version :9

Sequence 1:NP_651535.1 Gene:CAH9 / 43264 FlyBaseID:FBgn0039486 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_783639.1 Gene:Ca11 / 308588 RGDID:735155 Length:328 Species:Rattus norvegicus


Alignment Length:330 Identity:83/330 - (25%)
Similarity:128/330 - (38%) Gaps:86/330 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 AFLEASFLLICWSQ-AVSSHV---------FGYSE-------PNQRRWARHHGH---CA-GKTQS 48
            |.|.|...|:.|:. ..::|:         :.|.|       |....|...:..   || ||.||
  Rat     5 ARLSAPQALVLWAALGAAAHIGPAPDPEDWWSYKENLQGNFVPGPPFWGLVNAAWSLCAVGKRQS 69

  Fly    49 PIAITTSRTTAIHMPAVDMIGYHNLLPYPLKMINNGHTVSITI--------------PKVNVTEV 99
            |:.:...|           :.|...|| ||::...|..:..|:              |.|||:  
  Rat    70 PVDVELKR-----------VLYDPFLP-PLRLSTGGEKLRGTLYNTGRHVSFLPASRPVVNVS-- 120

  Fly   100 GEDFLPYIRGAKLPGEFEVEGLHFHWGDKNNRGSEHVINDIRYTMEMHIVHRNKK-YATIGEALN 163
                     |..|.....:..|...:|.::..||||.||...::.|:.::|.|:: |..:..|..
  Rat   121 ---------GGPLLYSHRLSELRLLFGARDGAGSEHQINHQGFSAEVQLIHFNQELYGNLSAASR 176

  Fly   164 HPDGAAVLGFFFNLDEDEGAGL-----------VTINRHLHLIADANQEATLNVTFSLSSLIAGV 217
            .|:|.|:|..|.|:.......|           ::.....:.:.|.:.|.....:|.        
  Rat   177 GPNGLAILSLFVNVAGSSNPFLSRLLNRDTITRISYKNDAYFLQDLSLELLFPESFG-------- 233

  Fly   218 DVDKFYTYKGSLTTPPCSEAVTWILFPDPIPISPKQISRFRQLSDTQDG----ALVDNFRTLQPV 278
                |.||:|||:||||||.|||||....:.|:..|:...|.||.....    :|..|.|.|||:
  Rat   234 ----FITYQGSLSTPPCSETVTWILIDRALNITSLQMHSLRLLSQNPPSQIFQSLSGNGRPLQPL 294

  Fly   279 GNRRI 283
            .:|.:
  Rat   295 AHRAL 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH9NP_651535.1 Carb_anhydrase 25..282 CDD:215000 76/297 (26%)
Ca11NP_783639.1 alpha_CARP_X_XI_like 48..304 CDD:239395 74/287 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339359
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.