DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH9 and Ca8

DIOPT Version :9

Sequence 1:NP_651535.1 Gene:CAH9 / 43264 FlyBaseID:FBgn0039486 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_001009662.1 Gene:Ca8 / 297814 RGDID:1304709 Length:290 Species:Rattus norvegicus


Alignment Length:274 Identity:89/274 - (32%)
Similarity:138/274 - (50%) Gaps:28/274 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 FGYSEPNQRRWARHHGHCAGKTQSPIAITTSRTTAIHMPAVDM-IGYHNLLPYPLKMINNGHTVS 88
            :||.|..:  |........|:.||||.: .||........:|: :..:.::....::.|:|||:.
  Rat    29 WGYEEGVE--WGLVFPDANGEYQSPINL-NSREARYDPSLLDVRLSPNYVVCRDCEVTNDGHTIQ 90

  Fly    89 ITIPKVNVTEVGEDFLPYIRGAKLP--GEFEVEGLHFHWGDKNNRGSEHVINDIRYTMEMHIVHR 151
            :.:...:|          :.|..||  .|||:..:.||||.:|.|||||.:|...:.||:|::|.
  Rat    91 VILKSKSV----------LSGGPLPQGQEFELYEVRFHWGRENQRGSEHTVNFKAFPMELHLIHW 145

  Fly   152 NKK-YATIGEALNHPDGAAVLGFFFNLDEDEGAGLVTINRHLHLIADANQEATLNVTFSLSSLIA 215
            |.. :.:|.||:..|.|..::..|..:.: |..||..:...|..|....:..|: ..|:.::|:.
  Rat   146 NSTLFGSIDEAVGKPHGIVIIALFVQIGK-EHVGLKAVTEILQDIQYKGKSKTI-PCFNPNTLLP 208

  Fly   216 GVDVDKFYTYKGSLTTPPCSEAVTWILFPDPIPISPKQISRFR---------QLSDTQDGALVDN 271
            ...:..::.|:||||.|||||.||||||..|:.||..||..||         :|.:..||.|.||
  Rat   209 DPLLRDYWVYEGSLTIPPCSEGVTWILFRYPLTISQLQIEEFRRLRTHVKGAELVEGCDGILGDN 273

  Fly   272 FRTLQPVGNRRIFA 285
            ||..||:.:|.|.|
  Rat   274 FRPTQPLSDRVIRA 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH9NP_651535.1 Carb_anhydrase 25..282 CDD:215000 86/269 (32%)
Ca8NP_001009662.1 alpha_CARP_VIII 35..289 CDD:239394 86/268 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339394
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X57
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.750

Return to query results.
Submit another query.