DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH9 and Car15

DIOPT Version :9

Sequence 1:NP_651535.1 Gene:CAH9 / 43264 FlyBaseID:FBgn0039486 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_001099371.1 Gene:Car15 / 288360 RGDID:1306018 Length:323 Species:Rattus norvegicus


Alignment Length:299 Identity:99/299 - (33%)
Similarity:150/299 - (50%) Gaps:22/299 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 FLLICWSQAVSSHVFGYSEPNQR----RWARHHGHCAGKTQSPIAI---TTSRTTAIHMPAVDMI 68
            |||:..:|..|:..:.|...:.:    .|......|.|.||||:.|   ...|..|: .|.: ..
  Rat    10 FLLMLAAQVDSNGTWCYDSQDPKCGPAHWKELAPACGGPTQSPVNIDLRLVQRDYAL-KPFI-FH 72

  Fly    69 GYHNLLPYPLKMINNGHTVSITIPKVNVTEVGEDFLPYIRGAKLP-GEFEVEGLHFHWGDKNNRG 132
            ||.:....|..:.|:||||.:.:...      :...|.||||.|| .|:.:..||||||...::|
  Rat    73 GYDSAPQDPWILENDGHTVLLRVHSC------QQNCPAIRGAGLPSSEYRLLQLHFHWGSPGHKG 131

  Fly   133 SEHVINDIRYTMEMHIVHRNKKYATIGEALNHPDGAAVLGFFFNLDEDEGAGLVTINRHLHLIAD 197
            |||.:::...:||||:||.|.||.::|.|.:.|||.|:|......::.:......|...|..::.
  Rat   132 SEHSVDEKHGSMEMHMVHMNTKYQSMGHARSQPDGLAILAVLLVEEDKDNTNFSAIVSGLKNVSS 196

  Fly   198 ANQEATLNVTFSLSSLI-AGVDVDKFYTYKGSLTTPPCSEAVTWILFPDPIPISPKQISRFRQLS 261
            ......|..||:|:||: :.:.:.::|.|.||||||.|..||.|.:|.:.:||...|:.:|:.:.
  Rat   197 PGVSVNLTSTFALASLLPSALGLLRYYRYSGSLTTPGCEPAVLWTVFENTVPIGHAQVVQFQAVP 261

  Fly   262 DT-----QDGALVDNFRTLQPVGNRRIFARTGHVRHTSI 295
            .|     ....|.||||..||:|.|||.|..|....:|:
  Rat   262 QTGPPGLHPRPLTDNFRPQQPLGGRRISASPGASIRSSV 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH9NP_651535.1 Carb_anhydrase 25..282 CDD:215000 88/270 (33%)
Car15NP_001099371.1 alpha_CA_IV_XV_like 47..290 CDD:239391 88/250 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR18952
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.