DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH9 and Car14

DIOPT Version :9

Sequence 1:NP_651535.1 Gene:CAH9 / 43264 FlyBaseID:FBgn0039486 Length:311 Species:Drosophila melanogaster
Sequence 2:XP_006501505.1 Gene:Car14 / 23831 MGIID:1344341 Length:460 Species:Mus musculus


Alignment Length:288 Identity:99/288 - (34%)
Similarity:142/288 - (49%) Gaps:27/288 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 ASFLLICWSQAV-SSHVFGYSEPN-QRRWARHHGHCAGKTQSPIAITTSRTTAI---HMPAVDMI 68
            |..|.:.|..|. ..|.:.|..|: |..|...:..|.|..||||.|.|.  :.|   .:|||...
Mouse     5 ALLLKVTWILAADGGHHWTYEGPHGQDHWPTSYPECGGDAQSPINIQTD--SVIFDPDLPAVQPH 67

  Fly    69 GYHNLLPYPLKMINNGHTVSITIPKVNVTEVGEDFLPYIRGAKLPGEFEVEGLHFHWGDKNN-RG 132
            ||..|...||.:.||||||.:::|            |.:....||.::....||.|||.:.: .|
Mouse    68 GYDQLGTEPLDLHNNGHTVQLSLP------------PTLHLGGLPRKYTAAQLHLHWGQRGSLEG 120

  Fly   133 SEHVINDIRYTMEMHIVH-RNKKYATIGEALNHPDGAAVLGFFFNLDEDEGAGLVTINRHLHLIA 196
            |||.||......|:|:|| .::.|:::.||...|.|.||||....:.|.|......|...||.|.
Mouse   121 SEHQINSEATAAELHVVHYDSQSYSSLSEAAQKPQGLAVLGILIEVGETENPAYDHILSRLHEIR 185

  Fly   197 DANQEATLNVTFSLSSLIAGVDVDKFYTYKGSLTTPPCSEAVTWILFPDPIPISPKQISRFRQ-L 260
            ..:|:.:: ..||:..|.. ..:::|:.|.||||||||.::|.|.:|.....||..|:.:.:: |
Mouse   186 YKDQKTSV-PPFSVRELFP-QQLEQFFRYNGSLTTPPCYQSVLWTVFNRRAQISMGQLEKLQETL 248

  Fly   261 SDTQDG---ALVDNFRTLQPVGNRRIFA 285
            |.|::.   .||.|:|..||:..|.|||
Mouse   249 SSTEEDPSEPLVQNYRVPQPLNQRTIFA 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH9NP_651535.1 Carb_anhydrase 25..282 CDD:215000 90/266 (34%)
Car14XP_006501505.1 alpha_CA_XII_XIV 29..278 CDD:239400 92/264 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100138
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X57
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.720

Return to query results.
Submit another query.