DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH9 and CA14

DIOPT Version :9

Sequence 1:NP_651535.1 Gene:CAH9 / 43264 FlyBaseID:FBgn0039486 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_036245.1 Gene:CA14 / 23632 HGNCID:1372 Length:337 Species:Homo sapiens


Alignment Length:287 Identity:97/287 - (33%)
Similarity:140/287 - (48%) Gaps:25/287 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 ASFLLICWSQAV--SSHVFGYSEPN-QRRWARHHGHCAGKTQSPIAI-TTSRTTAIHMPAVDMIG 69
            |..|.:.|..|.  ..| :.|..|: |..|...:..|....||||.| |.|.|....:||:...|
Human     5 ALLLEVIWILAADGGQH-WTYEGPHGQDHWPASYPECGNNAQSPIDIQTDSVTFDPDLPALQPHG 68

  Fly    70 YHNLLPYPLKMINNGHTVSITIPKVNVTEVGEDFLPYIRGAKLPGEFEVEGLHFHWGDKNN-RGS 133
            |......||.:.||||||.:::|..          .|:.|  ||.::....||.|||.|.: .||
Human    69 YDQPGTEPLDLHNNGHTVQLSLPST----------LYLGG--LPRKYVAAQLHLHWGQKGSPGGS 121

  Fly   134 EHVINDIRYTMEMHIVHRNK-KYATIGEALNHPDGAAVLGFFFNLDEDEGAGLVTINRHLHLIAD 197
            ||.||......|:||||.:. .|.::.||...|.|.||||....:.|.:......|..|||.:..
Human   122 EHQINSEATFAELHIVHYDSDSYDSLSEAAERPQGLAVLGILIEVGETKNIAYEHILSHLHEVRH 186

  Fly   198 ANQEATLNVTFSLSSLIAGVDVDKFYTYKGSLTTPPCSEAVTWILFPDPIPISPKQISRFR-QLS 261
            .:|:.:: ..|:|..|:. ..:.:::.|.||||||||.::|.|.:|.....||.:|:.:.: .|.
Human   187 KDQKTSV-PPFNLRELLP-KQLGQYFRYNGSLTTPPCYQSVLWTVFYRRSQISMEQLEKLQGTLF 249

  Fly   262 DTQD---GALVDNFRTLQPVGNRRIFA 285
            .|::   ..||.|:|.|||:..|.:||
Human   250 STEEEPSKLLVQNYRALQPLNQRMVFA 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH9NP_651535.1 Carb_anhydrase 25..282 CDD:215000 89/264 (34%)
CA14NP_036245.1 alpha_CA_XII_XIV 29..278 CDD:239400 90/262 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100138
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X57
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.720

Return to query results.
Submit another query.