DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH9 and cah-4

DIOPT Version :9

Sequence 1:NP_651535.1 Gene:CAH9 / 43264 FlyBaseID:FBgn0039486 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_510265.1 Gene:cah-4 / 181478 WormBaseID:WBGene00000282 Length:280 Species:Caenorhabditis elegans


Alignment Length:186 Identity:61/186 - (32%)
Similarity:90/186 - (48%) Gaps:23/186 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 YIRGAKLP-GEFEVEGLHFHWGDKNNRGSEHVINDIRYTMEMHIVHRNKKYATIGEALNHPDGAA 169
            ::....|| .:|.:...|.|||..:..||||.::..:.:.|:|.|..|..|.:...||:.|||.|
 Worm   104 FLTANHLPSSKFALAQFHAHWGSNSKEGSEHFLDGKQLSGEVHFVFWNTSYESFNVALSKPDGLA 168

  Fly   170 VLGFFFNLDEDEGAGLVTINRHLHLIADANQEATLNVT-------FSLSSLIAGVDVDKFYTYKG 227
            |:|.|..    ||    ..|.:.|.:.|..::||.|.|       |.:..|:...|..:|.||.|
 Worm   169 VVGVFLK----EG----KYNDNYHGLIDTVRKATGNATPIAMPKDFHIEHLLPSPDKREFVTYLG 225

  Fly   228 SLTTPPCSEAVTWILFPDPIPISPKQISRFRQLSDTQDGALVDNFRTLQPVGNRRI 283
            ||||||.:|.|.|.||.:|:.:|..|::..|.:       :..|.|..|...:|.|
 Worm   226 SLTTPPYNECVIWTLFTEPVEVSFGQLNVLRNI-------IPANHRACQDRCDREI 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH9NP_651535.1 Carb_anhydrase 25..282 CDD:215000 59/183 (32%)
cah-4NP_510265.1 alpha_CA 50..275 CDD:238200 61/186 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 1 1.000 - - otm14370
orthoMCL 1 0.900 - - OOG6_100138
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.