DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH9 and Ptprg

DIOPT Version :9

Sequence 1:NP_651535.1 Gene:CAH9 / 43264 FlyBaseID:FBgn0039486 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_599183.2 Gene:Ptprg / 171357 RGDID:620774 Length:1442 Species:Rattus norvegicus


Alignment Length:257 Identity:80/257 - (31%)
Similarity:118/257 - (45%) Gaps:22/257 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 WARHHGHCAGKTQSPIAITTSRT-TAIHMPAVDMIGYHNLLPYPLKMINNGHTVSITIPKVNVTE 98
            |......|.|..||||.|..... .......:.:.|:.|.......|.|.|.||:|.:.      
  Rat    71 WVTSSVSCGGSHQSPIDILDHHARVGEEYQELQLDGFDNESSNKTWMKNTGKTVAILLK------ 129

  Fly    99 VGEDFLPYIRGAKLPGEFEVEGLHFHWGDKN-NRGSEHVINDIRYTMEMHIVHRN-KKYATIGEA 161
              :|:  ::.||.|||.|:.|.:.||||..| :.||||.:|..|:.:||.|...| ..:.:...|
  Rat   130 --DDY--FVSGAGLPGRFKAEKVEFHWGHSNGSAGSEHSVNGRRFPVEMQIFFYNPDDFDSFQTA 190

  Fly   162 LNHPDGAAVLGFFFNLDEDEGAGLVTINRHLHLIADANQEATLNVTFSLSSLIAGVDVDKFYTYK 226
            ::.......:..||.:...:.:.|..|...|..:....:|..|: .|.|..|:. ..:..:|.|.
  Rat   191 ISENRIIGAMAIFFQVSPRDNSALDPIIHGLKGVVHHEKETFLD-PFVLRDLLP-ASLGSYYRYT 253

  Fly   227 GSLTTPPCSEAVTWILFPDPIPISPKQISRFRQL--SDTQDGA-----LVDNFRTLQPVGNR 281
            ||||||||||.|.||:|..|:|||..|:..|..:  ::.||..     |.:|||..|.:.:|
  Rat   254 GSLTTPPCSEIVEWIVFRRPVPISYHQLEAFYSIFTTEQQDHVKSVEYLRNNFRPQQALNDR 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH9NP_651535.1 Carb_anhydrase 25..282 CDD:215000 80/257 (31%)
PtprgNP_599183.2 alpha_CARP_receptor_like 67..319 CDD:239396 80/257 (31%)
FN3 348..438 CDD:238020
R-PTPc-G-1 845..1118 CDD:350505
R-PTP-G-2 1202..1406 CDD:350508
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.