DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH9 and Car11

DIOPT Version :9

Sequence 1:NP_651535.1 Gene:CAH9 / 43264 FlyBaseID:FBgn0039486 Length:311 Species:Drosophila melanogaster
Sequence 2:XP_006540651.1 Gene:Car11 / 12348 MGIID:1336193 Length:344 Species:Mus musculus


Alignment Length:330 Identity:83/330 - (25%)
Similarity:128/330 - (38%) Gaps:86/330 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 AFLEASFLLICWSQ-AVSSHV---------FGYSE-------PNQRRWARHHGH---CA-GKTQS 48
            |.|.|...|:.|:. ..::|:         :.|.|       |....|...:..   || ||.||
Mouse     5 ARLSAPQALVLWAALGAAAHIGPAPDPEDWWSYKENLQGNFVPGPPFWGLVNAAWSLCAVGKRQS 69

  Fly    49 PIAITTSRTTAIHMPAVDMIGYHNLLPYPLKMINNGHTVSITI--------------PKVNVTEV 99
            |:.:...|           :.|...|| ||::...|..:..|:              |.|||:  
Mouse    70 PVDVELKR-----------VLYDPFLP-PLRLSTGGEKLRGTLYNTGRHVSFLPASRPVVNVS-- 120

  Fly   100 GEDFLPYIRGAKLPGEFEVEGLHFHWGDKNNRGSEHVINDIRYTMEMHIVHRNKK-YATIGEALN 163
                     |..|.....:..|...:|.::..||||.||...::.|:.::|.|:: |..:..|..
Mouse   121 ---------GGPLLYSHRLSELRLLFGARDGAGSEHQINHEGFSAEVQLIHFNQELYGNLSAASR 176

  Fly   164 HPDGAAVLGFFFNLDEDEGAGL-----------VTINRHLHLIADANQEATLNVTFSLSSLIAGV 217
            .|:|.|:|..|.|:.......|           ::.....:.:.|.:.|.....:|.        
Mouse   177 GPNGLAILSLFVNVAGSSNPFLSRLLNRDTITRISYKNDAYFLQDLSLELLFPESFG-------- 233

  Fly   218 DVDKFYTYKGSLTTPPCSEAVTWILFPDPIPISPKQISRFRQLSDTQDG----ALVDNFRTLQPV 278
                |.||:|||:||||||.|||||....:.|:..|:...|.||.....    :|..|.|.|||:
Mouse   234 ----FITYQGSLSTPPCSETVTWILIDRALNITSLQMHSLRLLSQNPPSQIFQSLSGNGRPLQPL 294

  Fly   279 GNRRI 283
            .:|.:
Mouse   295 AHRAL 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH9NP_651535.1 Carb_anhydrase 25..282 CDD:215000 76/297 (26%)
Car11XP_006540651.1 alpha_CARP_X_XI_like 48..304 CDD:239395 74/287 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167835728
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.