DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH9 and ca3

DIOPT Version :9

Sequence 1:NP_651535.1 Gene:CAH9 / 43264 FlyBaseID:FBgn0039486 Length:311 Species:Drosophila melanogaster
Sequence 2:XP_002939197.2 Gene:ca3 / 100496328 XenbaseID:XB-GENE-1007186 Length:262 Species:Xenopus tropicalis


Alignment Length:282 Identity:91/282 - (32%)
Similarity:133/282 - (47%) Gaps:46/282 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 HVFGYSEPN-QRRWARHHGHCAGKTQSPIAITTSRT---------TAIHMPAVDMIGYHNLLPYP 77
            |.:||:..| ...||.:.....|..||||.:.|...         |:.:.|:..           
 Frog     5 HDWGYASHNGPDTWAEYFPAAKGDQQSPIELLTRYIKHDPTLRPWTSTYHPSTS----------- 58

  Fly    78 LKMINNGHTVSITIPKVNVTEVGEDFLPYIRGAKLPGEFEVEGLHFHWGDKNNRGSEHVINDIRY 142
            |.::|:|.|..:.........|       |:...:.|.:.:..|.||||..::.||||||:..||
 Frog    59 LTVVNDGTTCRVVFDDSTDKSV-------IKDGPMNGTYRLRQLQFHWGSSDDHGSEHVIDGFRY 116

  Fly   143 TMEMHIVHRNKKYATIGEALNHPDGAAVLGFFFNLDEDEGAGLVTINRHLHLIADA-----NQEA 202
            ..|||.:|.|.||..|.||..||||.|::..|..:.:        ...||.|:.:|     |:..
 Frog   117 AGEMHFIHWNSKYDNITEAKKHPDGVAIIAVFLKIGK--------AKPHLKLVLEALDCIKNKGK 173

  Fly   203 TLNVTFSLSSLIAGVDVDKFYTYKGSLTTPPCSEAVTWILFPDPIPISPKQISRFRQLSDTQDGA 267
            ..:.|....:::.....| ::||:||.|||||.|.|||:|..:||.:||:|:.:||.:..|.:|.
 Frog   174 KAHFTDFDPTILFPSSRD-YWTYQGSFTTPPCEECVTWLLLSEPITVSPEQMEKFRSVYSTLEGE 237

  Fly   268 ----LVDNFRTLQPVGNRRIFA 285
                :|||||..|||..|.|.|
 Frog   238 IECHMVDNFRPPQPVKGREIRA 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH9NP_651535.1 Carb_anhydrase 25..282 CDD:215000 87/275 (32%)
ca3XP_002939197.2 alpha_CA 4..261 CDD:412109 91/282 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X57
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.