DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH9 and Car10

DIOPT Version :9

Sequence 1:NP_651535.1 Gene:CAH9 / 43264 FlyBaseID:FBgn0039486 Length:311 Species:Drosophila melanogaster
Sequence 2:XP_017453181.1 Gene:Car10 / 100360015 RGDID:2322930 Length:328 Species:Rattus norvegicus


Alignment Length:318 Identity:87/318 - (27%)
Similarity:144/318 - (45%) Gaps:72/318 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LEASFLLICWSQAVSSHV----FGYSE-------PNQRRWARHHGH---CA-GKTQSPIAITTSR 56
            |:|:|::...:|..|..:    :.|.|       |....|...:..   |: ||.|||:.|.|| 
  Rat    11 LQANFIVCISAQQNSPKIHEGWWAYKEVVQGSFVPVPSFWGLVNSAWNLCSVGKRQSPVNIETS- 74

  Fly    57 TTAIHMPAVDMIGYHNLLPY--PLK-----------MINNGHTVSITIPKVNVTEVGEDFLPYIR 108
                || ..|        |:  ||:           |.|.|..||:.:.|        :.|..|.
  Rat    75 ----HM-IFD--------PFLTPLRINTGGRKVSGTMYNTGRHVSLRLDK--------EHLVNIS 118

  Fly   109 GAKLPGEFEVEGLHFHWGDKNNRGSEHVINDIRYTMEMHIVHRNKK-YATIGEALNHPDGAAVLG 172
            |..:.....:|.:..|:|.::::||||::|...::.|:.::|.|.: |..:.||...|:|..|:.
  Rat   119 GGPMTYSHRLEEIRLHFGSEDSQGSEHLLNGQAFSGEVQLIHYNHELYTNVTEAAKSPNGLVVVS 183

  Fly   173 FFFNLDEDEGAGLVTINRHLHLIADANQEATLNVTFSLSS-LIAGVDVDKFY-------TYKGSL 229
            .|..:.:.....|   ||.|      |::....:|:...: |:.|:::::.|       ||.||:
  Rat   184 IFIKVSDSSNPFL---NRML------NRDTITRITYKNDAYLLQGLNIEELYPETSSFITYDGSM 239

  Fly   230 TTPPCSEAVTWILFPDPIPISPKQISRFRQLSDTQDG----ALVDNFRTLQPVGNRRI 283
            |.|||.|..:||:...|:.|:..|:...|.||..|..    ::.||||.:||:.||.|
  Rat   240 TIPPCYETASWIIMNKPVYITRMQMHSLRLLSQNQPSQIFLSMSDNFRPVQPLNNRCI 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH9NP_651535.1 Carb_anhydrase 25..282 CDD:215000 80/293 (27%)
Car10XP_017453181.1 alpha_CARP_X_XI_like 46..302 CDD:239395 79/283 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.