DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH9 and ca6

DIOPT Version :9

Sequence 1:NP_651535.1 Gene:CAH9 / 43264 FlyBaseID:FBgn0039486 Length:311 Species:Drosophila melanogaster
Sequence 2:XP_009295179.1 Gene:ca6 / 100006448 ZFINID:ZDB-GENE-030131-7091 Length:538 Species:Danio rerio


Alignment Length:280 Identity:95/280 - (33%)
Similarity:144/280 - (51%) Gaps:27/280 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 SQAVSSHVFGYS-EPNQRRWARHHGHCAGKTQSPIAITTSRTT-AIHMPAVDMIGYHNLLPYPLK 79
            |..|....:.|| |.:|:.||..:..|.|:.||||.|...:.. :..|..:::.||.::....| 
Zfish    18 SAGVDGDYWTYSGELDQKHWAEKYHDCGGQQQSPIDIQRRKVRYSPRMQQLELTGYEDIRGSFL- 81

  Fly    80 MINNGHTVSITIPKVNVTEVGEDFLPYIRGAKLPGEFEVEGLHFHWG--DKNNRGSEHVINDIRY 142
            |.||||:|.|.:|  :..::.:.|         |.::....:|.|||  |....||||.::.|||
Zfish    82 MKNNGHSVEIQLP--STMKITKGF---------PHQYTAVQMHLHWGGWDLEASGSEHTMDGIRY 135

  Fly   143 TMEMHIVHRN-KKYATIGEALNHPDGAAVLGFFF---NLDEDEGAGLVTINRHLHLIADANQEAT 203
            ..|:|:||.| :||.:..||.|.|||.|||.|||   :.:....:..::...::..:..:...:.
Zfish   136 MAELHVVHYNSEKYPSFEEAKNKPDGLAVLAFFFEDGHFENTYYSDFISNLANIKYVGQSMSISN 200

  Fly   204 LNVTFSLSSLIAGVDVDKFYTYKGSLTTPPCSEAVTWILFPDPIPISPKQISRFRQ-LSDTQDGA 267
            |||...||.     ::..||.||||||||||.|:|.|.:|..||.:|..||.:... |.|..:..
Zfish   201 LNVLSMLSE-----NLSHFYRYKGSLTTPPCFESVMWTVFDTPITLSHNQIRKLESTLMDHDNKT 260

  Fly   268 LVDNFRTLQPVGNRRIFART 287
            |.:::|..||: |.|:...|
Zfish   261 LWNDYRMAQPL-NERVVEST 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH9NP_651535.1 Carb_anhydrase 25..282 CDD:215000 91/265 (34%)
ca6XP_009295179.1 alpha_CA 33..281 CDD:320708 90/265 (34%)
LamG 332..521 CDD:328935
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579099
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X57
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.