DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17189 and CG14259

DIOPT Version :9

Sequence 1:NP_001356927.1 Gene:CG17189 / 43263 FlyBaseID:FBgn0039485 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_651532.1 Gene:CG14259 / 43261 FlyBaseID:FBgn0039483 Length:289 Species:Drosophila melanogaster


Alignment Length:266 Identity:164/266 - (61%)
Similarity:211/266 - (79%) Gaps:2/266 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LIGLLMLLHAGLQGA--QCVAFYTEKPSYIESCKIYEPEFTKCSTRSIQAFMNQLVKGVPEIEES 65
            |:.:|.|....:..:  ..||:|:|||:::.||:||||.||||||.|||..::||..|:||:.|.
  Fly    17 LLAILCLNEIAMDRSLVSAVAYYSEKPAFLPSCRIYEPGFTKCSTNSIQKLLDQLNIGIPEVLER 81

  Fly    66 FGPIDPMRQEQLVFKQDNSDVATLSANLTDMLIRGFGKMLIKESKVSKKDFSWLTKIYLPQMRID 130
            |||.||||...:||||||::|||:.|||||::::||....:|||:||||||||.||||||:||:|
  Fly    82 FGPFDPMRVRDIVFKQDNNEVATIRANLTDLVVKGFANTKVKESRVSKKDFSWQTKIYLPKMRLD 146

  Fly   131 GHYKMVGRILLVPLQGNGKIVMEIDDLDILMTTKTRLYEKGGYTFYNVTSVKVKVDVGKVRTRLD 195
            |.|:|.|||||:||.|:|||.:||||||||:.||.|||||||:||.|||:|:|::::.||||.||
  Fly   147 GRYEMAGRILLIPLSGSGKIFIEIDDLDILLLTKIRLYEKGGFTFDNVTAVQVQLNLSKVRTYLD 211

  Fly   196 NLFNGHSKEVEDSTNQFFNDNWKDVFEALRPLVVETVERTLLDLLHKTFALFPASFFVEDIPTSL 260
            |||||.|||||.|||:|||:||:|.:|||:||:|||||..|.|::...|.|.||:||||||||..
  Fly   212 NLFNGRSKEVERSTNEFFNENWRDFYEALKPLIVETVENILYDVMSTVFHLIPANFFVEDIPTPQ 276

  Fly   261 TLYGRK 266
            .|||.|
  Fly   277 QLYGPK 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17189NP_001356927.1 JHBP 24..254 CDD:214779 148/229 (65%)
CG14259NP_651532.1 JHBP 32..269 CDD:284096 150/236 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470317
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H81354
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG27175
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0012742
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.