DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17189 and CG11854

DIOPT Version :9

Sequence 1:NP_001356927.1 Gene:CG17189 / 43263 FlyBaseID:FBgn0039485 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_651358.4 Gene:CG11854 / 43037 FlyBaseID:FBgn0039299 Length:250 Species:Drosophila melanogaster


Alignment Length:254 Identity:62/254 - (24%)
Similarity:120/254 - (47%) Gaps:20/254 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LLIGLLMLLHAGLQGAQCVAFY---TEKPSYIESCKIYEPEFTKCSTRSIQAFMNQLVK-GVPEI 62
            |.:.|::|.       .|.:.|   ::.||.||.|.|.:.:   |....:...:....| |:.|:
  Fly     3 LTLALVLLF-------GCASTYGHASDFPSGIERCAIMDEQ---CLEDRVNFVLRNYAKSGIKEL 57

  Fly    63 EESFGPIDPMRQEQLVFKQDNSDVATLSANLTDMLIRGFGKMLIKESKVSKKDFSWLTKIYL--P 125
              ...|:||:..::....::......:..:..:|.|.|..:.:.|......:|.|...::.:  |
  Fly    58 --GLIPLDPLHVKKFKIGRNPHSPVNIDLSFHEMDILGLHQGVAKRVSGFTRDLSRSIELVMEVP 120

  Fly   126 QMRIDGHYKMVGRILLVPLQGNGKIVMEIDDLDILMTTKTRLYEKGGY-TFYNVTSVKVKVDVGK 189
            ::.:.|.|.:.||||::|:.|||...:.:....:....|.:...||.: |:..|.::||::|...
  Fly   121 EIGVRGPYSVDGRILILPITGNGIADIRLTRTKVRAQIKLKRVSKGDHQTYAEVMNIKVELDPSH 185

  Fly   190 VRTRLDNLFNGHSKEVEDSTNQFFNDNWKDVFEALRPLVVETVERTLLDLLHKTFALFP 248
            |..:|:||||| .|::.::.:...|:||||:|..|:|.:.|........::.:.|...|
  Fly   186 VTYQLENLFNG-QKDLSENMHALINENWKDIFNELKPGIGEAFGLIAKSVVDRIFGKLP 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17189NP_001356927.1 JHBP 24..254 CDD:214779 57/229 (25%)
CG11854NP_651358.4 JHBP 21..249 CDD:214779 57/229 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470372
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.