DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17189 and to

DIOPT Version :9

Sequence 1:NP_001356927.1 Gene:CG17189 / 43263 FlyBaseID:FBgn0039485 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001287525.1 Gene:to / 43036 FlyBaseID:FBgn0039298 Length:249 Species:Drosophila melanogaster


Alignment Length:252 Identity:59/252 - (23%)
Similarity:115/252 - (45%) Gaps:38/252 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 AFYTEKPSYIESCKIYEPE--FTKCSTRSIQAFMNQLVKGVPEIEESFGPIDPMRQEQLVFKQ-D 82
            |.:.|.|   :.||..:.|  ...|:|    .|.....:|.|.:  :...:||::.:::|..| :
  Fly    18 AKFPEDP---KPCKYGDGECIMKLCNT----LFSENSAEGDPGL--NLMQLDPLKVDRMVISQGE 73

  Fly    83 NSDVATLSANLTDML-----------IRGFGKMLI--KESKVSKKDFSWLTKIYLPQMRIDGHYK 134
            :|....::...||.|           ::|||:.|.  .|.|:..|.||           :.|.|.
  Fly    74 SSSPVGITLTFTDNLLYGIKDQRIVKVKGFGRDLTAKHEVKIVTKTFS-----------LVGPYN 127

  Fly   135 MVGRILLVPLQGNGKIVMEIDDLDILMTTKTRLYEKGGYTFYNVTSVKVKVDVGKVRTRLDNLFN 199
            :.|::|::|:.|.|:..|.:.::..:::...:...|.|.|:.:||.:|:.:..........||||
  Fly   128 IQGKVLILPISGTGQSNMTMVNVRAIVSFSGKPLVKNGETYLDVTDLKITMKPESSHYHFSNLFN 192

  Fly   200 GHSKEVEDSTNQFFNDNWKDVFEALRPLVVETVERTLLDLLHKTFALFP-ASFFVED 255
            | .|.:.|:.|.|.|:|.:.:::.....:..:..:..|.::...|:..| |.||.::
  Fly   193 G-DKALGDNMNVFLNENSEAIYKETAKAIDRSFGKLYLGVVKGVFSKLPYAKFFADE 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17189NP_001356927.1 JHBP 24..254 CDD:214779 58/246 (24%)
toNP_001287525.1 JHBP 5..245 CDD:284096 57/247 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470367
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.