DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17189 and CG17279

DIOPT Version :9

Sequence 1:NP_001356927.1 Gene:CG17189 / 43263 FlyBaseID:FBgn0039485 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_650937.3 Gene:CG17279 / 42489 FlyBaseID:FBgn0038850 Length:245 Species:Drosophila melanogaster


Alignment Length:228 Identity:53/228 - (23%)
Similarity:106/228 - (46%) Gaps:15/228 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 PSYIESCKIYEPEFTKCSTRSIQAFMNQLVKGVPEIEESFGPIDPMRQEQLVFKQDNSD-VATLS 90
            |..||.|:..:   :.|...::...:....||:|.|  ....:|.:..|.:|..:...| .:|..
  Fly    20 PPEIEKCRAGD---SICIAETVTRILRLYPKGLPSI--GLVALDSIGFEDVVVSRLEPDGSSTFD 79

  Fly    91 ANLTDMLIRGFGKMLIKESKVSKKDFSWLTKI--YLPQMRIDGHYKMVGRILLVPLQGNGKIVME 153
            ....::.:.||....:.|:|....|...:.::  ::|.::::|.|:|.|.:|.:|:.|.|:..:|
  Fly    80 LKFPNLTVIGFADSTVTEAKGFDADLPRVLELSGWIPLLKLNGTYEMRGSLLTMPIHGKGQAKVE 144

  Fly   154 IDDLDILMTTKTRLYE---KGGYTFYNVTSVKVKVDVGKVRTRLDNLFNGHSKEVEDSTNQFFND 215
            |.:..:  ..|.|:.|   ..|..:..::.||..:||..:...|:||||  :.|:.|:.|...|.
  Fly   145 IRECRV--RCKVRVLEDLRDDGKLYAGISKVKCLLDVQGMHLNLENLFN--NPEMSDAMNVVANT 205

  Fly   216 NWKDVFEALRPLVVETVERTLLDLLHKTFALFP 248
            .|.:::..||..:...|::.:..:|.:.....|
  Fly   206 KWLEIWHNLRRGITSAVDQLVESILQRVANKLP 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17189NP_001356927.1 JHBP 24..254 CDD:214779 53/228 (23%)
CG17279NP_650937.3 JHBP 5..243 CDD:336447 53/228 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470382
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.