DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17189 and CG7079

DIOPT Version :9

Sequence 1:NP_001356927.1 Gene:CG17189 / 43263 FlyBaseID:FBgn0039485 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001287436.1 Gene:CG7079 / 42488 FlyBaseID:FBgn0038849 Length:255 Species:Drosophila melanogaster


Alignment Length:242 Identity:57/242 - (23%)
Similarity:96/242 - (39%) Gaps:23/242 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 GAQCVAFYTEKPSYIESCKIYEPEFTKCSTRSIQAFMNQLVKGVPEIEESFGPIDPMR-QEQLVF 79
            |.||    .:.|:.::.|...:   .||...|..|.:....||:||::  ..|.:.:. ::.|:.
  Fly    16 GLQC----QKLPAKVKKCHFGD---GKCLVESANALLRDFPKGIPEVD--LKPFNVLSVRDWLLV 71

  Fly    80 KQDNSDVATLSANLTDMLIRGFGKMLIKESKVSKKDFSWLTKI----YLPQMRIDGHYKMVGRIL 140
            .......|....||.:.:..||....|.|.:...|| ...|||    .:|::...|.|...||:|
  Fly    72 NDSQVGGAWYYFNLINQINYGFENTTITEIRGFDKD-PTTTKIEIHGKIPRLVYKGDYVAKGRML 135

  Fly   141 -LVPLQGNGKIVMEIDDLDILMTTKTRLYEKGGYTFYNVTSVKVKVDVGKVRTRLDNLFNGHSKE 204
             .|.:...|....:..:...::|.|.|:..:....:..:..:...:.:.:....|||.|    .:
  Fly   136 WFVDIHSQGTSESDFLNFQFVLTLKVRVEYRNNKRYLKIYELVPNIRLDRWIMWLDNFF----PD 196

  Fly   205 VEDST---NQFFNDNWKDVFEALRPLVVETVERTLLDLLHKTFALFP 248
            .||.|   |..||.||.:.:..|.|.::...|...|.|....|...|
  Fly   197 NEDLTIAVNNLFNRNWVEFWNELEPGILRLFETVFLSLFEDLFEKVP 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17189NP_001356927.1 JHBP 24..254 CDD:214779 54/234 (23%)
CG7079NP_001287436.1 JHBP 20..249 CDD:214779 54/234 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470387
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.