DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17189 and CG2016

DIOPT Version :9

Sequence 1:NP_001356927.1 Gene:CG17189 / 43263 FlyBaseID:FBgn0039485 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001262270.1 Gene:CG2016 / 40612 FlyBaseID:FBgn0250839 Length:254 Species:Drosophila melanogaster


Alignment Length:264 Identity:59/264 - (22%)
Similarity:116/264 - (43%) Gaps:38/264 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLLIGLLMLLHAGLQGAQCVAFYTEKPSYIESCKIYEPEFTKCSTRSIQAFMNQLVKGVPEIEES 65
            |:.|.|:.:|.:        .|..|:|.|::.|...|.:..:|...|....::.|.|||||::  
  Fly     5 MVFIVLVAVLGS--------TFAQEQPYYLQQCPRDEAQINECLRESGNKLVHYLQKGVPELD-- 59

  Fly    66 FGPIDPMRQEQ--LVFKQDNSDVATLSANLTDMLIRGFGKMLIKESKVSKKDFSWL---TKIYLP 125
            ...|:|:..::  :|..........|..|     |:.:|...|..:.: :.|...|   ....:|
  Fly    60 IYEIEPVMIDEIGIVLGSGPDGYRALFRN-----IQAYGVSNITVTNI-RSDLDSLQFQLTCEIP 118

  Fly   126 QMRIDGHYKMVGRILLVPLQGNGKIVMEIDDLDILMTTKTRLYEKG-------GYTFYNVTSVKV 183
            ::|:...|:..|.::||...|.|....|.:.:      |.::|.|.       |.|:....|||:
  Fly   119 RIRVKAQYRSTGVLILVKASGAGDYWGEYEGV------KAKIYFKAVANEGPDGRTYLTTDSVKM 177

  Fly   184 KVDVGKVRTRLDNLFNGHS----KEVEDSTNQFFNDNWKDVFEALRPLVVETVERTLLDLLHKTF 244
            ..:|.:::..:||:.||::    ...|.:.|.|.|.|.:::.:.::|.:...:...:.:.:.:.|
  Fly   178 DFNVKEIQMGVDNIANGNTVILLSSTEAALNLFINSNSQELLKEMKPALRTKLTLVIRNFMDRIF 242

  Fly   245 ALFP 248
            |..|
  Fly   243 AKIP 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17189NP_001356927.1 JHBP 24..254 CDD:214779 54/241 (22%)
CG2016NP_001262270.1 JHBP 7..251 CDD:284096 58/262 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470464
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.