DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17189 and CG14661

DIOPT Version :9

Sequence 1:NP_001356927.1 Gene:CG17189 / 43263 FlyBaseID:FBgn0039485 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001246918.1 Gene:CG14661 / 40611 FlyBaseID:FBgn0037288 Length:246 Species:Drosophila melanogaster


Alignment Length:255 Identity:66/255 - (25%)
Similarity:114/255 - (44%) Gaps:27/255 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LLIGLLMLLHAGLQGAQCVAFYTEKPSYIESCKIYEPEFTKCSTRSIQAFMNQLVKGVPEIEESF 66
            |||..:..:.||           ..|.||:.|...:||.:||...|:......|.||:.|:  :.
  Fly    10 LLICFVACISAG-----------NMPDYIQVCHRNDPELSKCLKSSVHNLRPYLAKGIKEL--NV 61

  Fly    67 GPIDPMRQEQLVFKQDNSDVATLSANLTDMLIRGFGKMLIKESKVSKKDFSWLTKIYLPQMRIDG 131
            .|::|:....|.. .|.|...|:.|...::|  |.....|.:.:.|.::..:..::.||.:..||
  Fly    62 PPLEPLYIGDLSI-LDGSAGLTVKAKKLNIL--GASNFEITKLRASTQNRRFDFELILPHLHGDG 123

  Fly   132 HYKMVGRILLVPLQGNGKIVMEIDDLDILMTTKTRLYEKGGYTFYNVTSVKVKVDVGKVRTRLDN 196
            .|::.|.||.:|::|||.......:....:..:..:.......:.:|....:|:..||...:|:|
  Fly   124 LYEINGNILALPIKGNGPFTGNFTNFVAYVRVQYDIKSVNDLEYLHVKEFVLKIRTGKGNLKLEN 188

  Fly   197 LFNGHSKEVEDSTNQFFNDNWKDVF--EALRPLVVETVERTLLDLLHK-----TFA-LFP 248
            |||| .|.:.|..|...|.|: :||  :.:.| :...:|...|.:..|     |:: |||
  Fly   189 LFNG-DKVLGDVINDTINQNF-EVFTNDLIAP-IARALEAKFLVITTKILENFTYSELFP 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17189NP_001356927.1 JHBP 24..254 CDD:214779 61/233 (26%)
CG14661NP_001246918.1 JHBP 10..245 CDD:399529 64/253 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470426
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.