DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17189 and CG14457

DIOPT Version :9

Sequence 1:NP_001356927.1 Gene:CG17189 / 43263 FlyBaseID:FBgn0039485 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001014600.1 Gene:CG14457 / 40479 FlyBaseID:FBgn0037174 Length:271 Species:Drosophila melanogaster


Alignment Length:263 Identity:113/263 - (42%)
Similarity:165/263 - (62%) Gaps:3/263 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LIGLLMLLHAGLQGAQCVAFYTEKPSYIESCKIYEPEFTKCSTRSIQAFMNQLVKGVPEIEESFG 67
            ||.||:.....|..|: ..|..|.|.||:.|:|.:.:|..|||.|||...::|..|:|.: .|..
  Fly     6 LIVLLVTFTTCLVRAE-DGFLKEPPDYIKECRIADKDFVNCSTHSIQQLFDKLNDGIPGL-TSIR 68

  Fly    68 PIDPMRQEQLVFKQDNSDVATLSANLTDMLIRGFGKMLIKESKVSKKDFSWLTKIYLPQMRIDGH 132
            ..||....::...|.||:...|...|.::.|.|||...:.:|:|.|||:||.|...||:|::...
  Fly    69 SFDPFYLNRIRITQGNSNAINLKVELANVKIIGFGHTNVLDSQVFKKDYSWKTTFTLPEMKLQAD 133

  Fly   133 YKMVGRILLVPLQGNGKIVMEIDDLDILMTTKTRLYEKGGYTFYNVTSVKVKVDVGKVRTRLDNL 197
            |.:.|||||:||.|.|::.::.:::.:.|.||||||.|||:||||||::.|...:..:::...||
  Fly   134 YSLFGRILLIPLNGKGQVFLDAENMTVTMHTKTRLYSKGGFTFYNVTNLHVDFKMDGLKSYFSNL 198

  Fly   198 FNGHSKEVEDSTNQFFNDNWKDVFEALRPLVVETVERTLLDLLHKTFALFPASFFVEDIPTSLTL 262
            ||| :|::|||||:||||||:.:.:||..::.:|:|..|||:|.|.|...||:|||.||||...|
  Fly   199 FNG-NKQLEDSTNKFFNDNWRMLADALYTVITQTIEDILLDVLKKIFHFIPANFFVSDIPTPEQL 262

  Fly   263 YGR 265
            |||
  Fly   263 YGR 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17189NP_001356927.1 JHBP 24..254 CDD:214779 97/229 (42%)
CG14457NP_001014600.1 JHBP 6..253 CDD:284096 103/249 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470319
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H81354
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG27175
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0012742
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.