DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17189 and CG5945

DIOPT Version :9

Sequence 1:NP_001356927.1 Gene:CG17189 / 43263 FlyBaseID:FBgn0039485 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001260439.1 Gene:CG5945 / 34729 FlyBaseID:FBgn0032494 Length:250 Species:Drosophila melanogaster


Alignment Length:260 Identity:57/260 - (21%)
Similarity:115/260 - (44%) Gaps:22/260 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IGLLMLLHAGLQGAQCVAFYTEKPSY--IESCKIYEPEFTKCSTRSIQAFMNQLVKGVPEIEESF 66
            ||||.||..|     |.|..|:|..:  :..|...|.:..:|..:.......:|..|.||:.  .
  Fly     5 IGLLSLLALG-----CSAAPTDKNYFADLPKCSTEEDQLGECVKQLFNTLTPRLKDGNPELR--I 62

  Fly    67 GPIDPMRQEQLVFKQDNSDVATLSANLT--DMLIRGFGKMLIKESKV----SKKDFSWLTKIYLP 125
            .|.:|:...:..|:..:   .|::..:|  :..|.||.....||..|    .|.....:|:  :|
  Fly    63 EPYEPLHLNRTSFQYSS---GTVNGRITVRNAKIYGFSSNRAKEVSVKLNGDKVKLRLVTQ--MP 122

  Fly   126 QMRIDGHYKMVGRILLVPLQGNGKIVMEIDDLDILMTTKTRLYEKGGYTFYNVTSVKVKVDVGKV 190
            ::.|.|.||...::..:.|:..|:..:.:.|::.:..|...:|||.|:.|:.:.::..|..:..:
  Fly   123 KLNIVGSYKADMQVNQLQLKPKGEFNVTLLDVEAITVTDGEVYEKDGHRFFRLKNIDSKPKIKDL 187

  Fly   191 RTRLDNLFNGHSKEVEDSTNQFFNDNWKDVFEALRPLVVETVERTLLDLLHKTFALFPASFFVED 255
            ..:.:.:|  ...|::.......|..|:|::..:.|...:..:..:|.:.::.|.|.|...|:::
  Fly   188 VIKANGIF--ADPELDKIALNVANQYWRDIYGIMLPETRQFWQPLMLRMFNEAFELVPIDQFLKE 250

  Fly   256  255
              Fly   251  250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17189NP_001356927.1 JHBP 24..254 CDD:214779 48/237 (20%)
CG5945NP_001260439.1 JHBP 22..249 CDD:214779 47/235 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470542
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.