DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eater and dkk1a

DIOPT Version :9

Sequence 1:NP_651533.3 Gene:eater / 43262 FlyBaseID:FBgn0243514 Length:1074 Species:Drosophila melanogaster
Sequence 2:NP_001268729.2 Gene:dkk1a / 799377 ZFINID:ZDB-GENE-090313-406 Length:247 Species:Danio rerio


Alignment Length:268 Identity:57/268 - (21%)
Similarity:83/268 - (30%) Gaps:107/268 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 SPGRCICSARHLLDKTTNNCIPQCASGCPNGTCITPNNCSCNKGYKLNPTTQVCLPTC---KDNC 166
            ||...: ||...:..|.::..|      |:..|...:.||.  |...|.:..||| :|   :..|
Zfish    43 SPSDAV-SASPRVTGTVDSDAP------PSPHCSADSECSI--GEFCNGSRGVCL-SCRKRRKRC 97

  Fly   167 AAVNGFCAAPNRCECNPGFIPKPKSKSFECQPKCKNGCSNGVCRAPDKCECNKFYEKDIDGNCVP 231
            |. :|.|.|.||                         |.||||:..|.....       ..:..|
Zfish    98 AR-DGMCCAGNR-------------------------CINGVCQLADAAAVG-------SADASP 129

  Fly   232 ICENGCVNG-------NCTAPDVCQCLTGYTKIGHNVCLAVCPEGCQNG----VCVAPNECSCNA 285
            ...|..|:|       |.|.|.....|:.             |:..|.|    .|:..::|    
Zfish   130 PGGNTDVSGVAVTRGQNFTHPRRTTVLSK-------------PQQTQKGGEGETCLRSSDC---- 177

  Fly   286 GYTKLEGVC------TPVCKDGCVNG-FCASP-----------EKCSCNDGY-------EMDSEN 325
                |||:|      :.:||.....| .|...           ::|.|..|.       :..:|:
Zfish   178 ----LEGLCCARHFWSRICKPVLTEGQVCTRHRRKGAHGLEIFQRCDCGSGLTCRGQREKPGAES 238

  Fly   326 R----CSP 329
            |    |.|
Zfish   239 RNLHTCQP 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eaterNP_651533.3 None
dkk1aNP_001268729.2 Dickkopf_N 68..115 CDD:282549 20/75 (27%)
COLIPASE 167..236 CDD:305210 13/76 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.