DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eater and Esm1

DIOPT Version :9

Sequence 1:NP_651533.3 Gene:eater / 43262 FlyBaseID:FBgn0243514 Length:1074 Species:Drosophila melanogaster
Sequence 2:NP_076101.1 Gene:Esm1 / 71690 MGIID:1918940 Length:184 Species:Mus musculus


Alignment Length:174 Identity:44/174 - (25%)
Similarity:61/174 - (35%) Gaps:44/174 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 CSRGTCQSPGRCICSARHLLDKTTNNCIPQCASGCPNGTCITPNNCSCNKGYKLNPTTQVCLPTC 162
            |.:..|:|..||   .|.:||..  .|...||:| |..||.  ...|...|.|..|..:....:.
Mouse    32 CDKTECRSSLRC---KRTVLDDC--GCCQVCAAG-PGETCY--RTVSGMDGVKCGPGLKCHFYSE 88

  Fly   163 KDNCAAVNGFCAAPNRCECNPGFIPKPKSKSFECQPKCKNGCSNGVC-RAPDKCECNKFY----- 221
            :|:.....|.|.     :|..|      :...||:..|  .|.:|:| |...:|....|:     
Mouse    89 EDDFGDEFGICK-----DCPYG------TFGMECKETC--NCQSGICDRVTGRCLDFPFFQYAAA 140

  Fly   222 -----------EKDI---DGNCVPICENGCVNGNCTAPDVCQCL 251
                       |:|.   |||.|   ......||...|.|.:.|
Mouse   141 KSPSRTSASHTERDSASGDGNAV---REEIGEGNAARPSVMKWL 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eaterNP_651533.3 None
Esm1NP_076101.1 IGFBP 28..83 CDD:278641 19/58 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 145..184 11/40 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.