DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eater and Dkk4

DIOPT Version :9

Sequence 1:NP_651533.3 Gene:eater / 43262 FlyBaseID:FBgn0243514 Length:1074 Species:Drosophila melanogaster
Sequence 2:NP_001102802.1 Gene:Dkk4 / 502097 RGDID:1563172 Length:221 Species:Rattus norvegicus


Alignment Length:227 Identity:57/227 - (25%)
Similarity:74/227 - (32%) Gaps:76/227 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   471 FCVAPG---------KCSCD-EGYSKETGNSCKPICSKGCENG-FCDA--PEKCSCNDGYEMDGE 522
            ||...|         |.|.| :|..|  |:.|  :..|.|..| ||.|  .|:..|.....:  .
  Rat    12 FCSPLGALVLDFNNIKSSSDVQGSGK--GSQC--VSDKDCNVGKFCFALHDERSFCATCRRV--R 70

  Fly   523 NRC--SPVCSGG--CKNGFCVAPEKC-------------SCDEGYSK----ETGNSCKPICSNGC 566
            .||  |.:|..|  |.|..|.|.|..             :..||.:|    |.....||      
  Rat    71 RRCQRSAMCCPGTVCVNDVCTAVENTRPVMDRNTDGQDGTYAEGTTKWPAEENRPQGKP------ 129

  Fly   567 ENGFCDAPEKCSCNDGYEMDGENRCSPVCSGGCKNGFCVAPGKCSCDEGYSKETGNSCKP----- 626
                  :.:|...|.|.|  ||:         |.......||.|.....::|    .|||     
  Rat   130 ------STKKSQSNKGQE--GES---------CLRTSDCGPGLCCARHFWTK----ICKPVLLEG 173

  Fly   627 -ICSKGCENGFCDAPE---KCSCNDGYEMDSE 654
             :||:........|||   :|.|..|....|:
  Rat   174 QVCSRRGHKDTAQAPEIFQRCDCGPGLSCRSQ 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eaterNP_651533.3 None
Dkk4NP_001102802.1 Dickkopf_N 41..91 CDD:282549 16/53 (30%)
Prokineticin <145..202 CDD:148298 16/60 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.