powered by:
Protein Alignment eater and NimB3
DIOPT Version :9
Sequence 1: | NP_651533.3 |
Gene: | eater / 43262 |
FlyBaseID: | FBgn0243514 |
Length: | 1074 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001033905.1 |
Gene: | NimB3 / 3885611 |
FlyBaseID: | FBgn0054003 |
Length: | 122 |
Species: | Drosophila melanogaster |
Alignment Length: | 49 |
Identity: | 24/49 - (48%) |
Similarity: | 31/49 - (63%) |
Gaps: | 4/49 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 348 CDEGYI-KGTGNS--CKPICSKGCENGFCDAPEKCSCNDGYEMDGENRC 393
|.:||: |||..: |:||||:.|.||.|.|||:|.|..||....: ||
Fly 70 CCDGYVNKGTSQNLKCEPICSEDCSNGLCLAPEECECAPGYYRSNK-RC 117
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
eater | NP_651533.3 |
None |
NimB3 | NP_001033905.1 |
PLN03223 |
<49..>106 |
CDD:215637 |
19/35 (54%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG1218 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D97941at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.910 |
|
Return to query results.
Submit another query.