DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eater and CG15861

DIOPT Version :9

Sequence 1:NP_651533.3 Gene:eater / 43262 FlyBaseID:FBgn0243514 Length:1074 Species:Drosophila melanogaster
Sequence 2:NP_001286863.1 Gene:CG15861 / 37990 FlyBaseID:FBgn0035084 Length:205 Species:Drosophila melanogaster


Alignment Length:210 Identity:59/210 - (28%)
Similarity:84/210 - (40%) Gaps:46/210 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 GYVNLNNDPSNRCVPYCKGCSRGTCQSPGRCICSARHLLDKTTNNCIPQCASGCPNGTCITPNNC 143
            ||..: |:||.                    :||...:|...|..|:.:|...|.||.|....:|
  Fly    25 GYWEI-NEPSQ--------------------LCSDYEMLVVNTRQCVRRCNIVCLNGVCFEDGSC 68

  Fly   144 SCNKGYKL-NPTTQVCLPTCKDNCAAVNGFCAAPNRCECNPG----FIP---KPKSKSFECQPKC 200
            .|...|.. ||...||...|...|.|..|:||||:.|.|...    |.|   |.:.::......|
  Fly    69 PCADQYMAGNPDGLVCAAECLPGCVAAGGYCAAPDLCVCREDRHYYFDPLSQKCRHRAPRLLDPC 133

  Fly   201 KNGCSNGVCRAPDKCECNKFYE-KD--IDG-NCVPICENGC-VNGNCTAPDVCQCLTGYTKIGHN 260
            ...|::|.|.:..:|.|.:.|| :|  :.| .|:|||::.| ....|.||::|.|........| 
  Fly   134 LGRCTHGNCSSDGRCICAQGYELRDSLLHGQQCMPICDHNCGPRAYCFAPNLCACRHKQHHYAH- 197

  Fly   261 VCLAVCPEGCQNGVC 275
                       ||:|
  Fly   198 -----------NGIC 201



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D97941at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24047
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.