DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eater and abu-4

DIOPT Version :9

Sequence 1:NP_651533.3 Gene:eater / 43262 FlyBaseID:FBgn0243514 Length:1074 Species:Drosophila melanogaster
Sequence 2:NP_872210.1 Gene:abu-4 / 353458 WormBaseID:WBGene00000027 Length:339 Species:Caenorhabditis elegans


Alignment Length:451 Identity:91/451 - (20%)
Similarity:134/451 - (29%) Gaps:164/451 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   485 SKETGNSCKPICSKGCENGFCDAPE---KCSCND-GYEMDGENRCSPVCSGGCKNGFCVAP--EK 543
            ::|...||      ||      ||.   .|||.. .|....:..||      |:|   .||  ..
 Worm    24 TREKRQSC------GC------APRVQPSCSCQQTTYAQPPQYSCS------CQN---TAPVQTS 67

  Fly   544 CSCDEGYSKET----GNSCKPICSNGCENGFCDAPEKCSCNDGYEMDGENRCSPVCSGGCKNGFC 604
            |||.:...::|    .:.|.|.|...|:.....||            ..::|...|...|:...|
 Worm    68 CSCAQPVQQQTYQVQASQCAPACQQSCQMQCQSAP------------SVSQCQSTCQQSCQASSC 120

  Fly   605 VAPGKCSCDEGYSKETGNSCKPICSKGCENGFCDAPEKCSCNDGYEMDSENRCSPVCSGGCKNGF 669
            ..|....|..        ||.|.|.:.|   ...||:..|.|.......:.:|:|.|....    
 Worm   121 YTPAPVQCQP--------SCMPACKQSC---VAPAPQIISLNLEVVPQCQQQCAPQCQQAS---- 170

  Fly   670 CIAPGKCSCDEGYSKETGNSCK---PICSKGCENGFCDAPEKCSCNDGYEMDSENRCSPVCSGGC 731
              ||....|.        |:|:   |:|                         :.:|:|.|:   
 Worm   171 --APQCQQCQ--------NTCQQFAPVC-------------------------QQQCAPQCT--- 197

  Fly   732 KNGFCVAPGKCSCDEGYSKETGNSCKPICSKGCENGFCEAPEKCSCNDGYEMDGENRCSPVCSGG 796
               ...||....|     :.|.....|:|.:.|... |:.|....|..             |...
 Worm   198 ---ISSAPQCQQC-----QTTCQQFAPVCQQQCAPQ-CQQPSAPQCQQ-------------CQSA 240

  Fly   797 CKNGF---CIAPGKCSCDEGYSRETGNSCKPICSKGCENGFCDAPEKCSCNDGYEMDSENRCSPV 858
            |::..   .:||...:.....|......|:|.|.:.|:       ::|.    .:.....:|:|.
 Worm   241 CQSPVVAPVVAPQIVTVILEASVSQSAQCEPECQQSCQ-------QQCV----QQQQPMIQCAPA 294

  Fly   859 CSGGCKNGFCVAP-----------GKCSCDEGYSKETEISCAPFCKDGCVNGLCVSPDFCK 908
            |:..|.....:|.           ..|||.:.||.             |.||.|     ||
 Worm   295 CTQSCSQSCSIAQPAQMPCMTESINSCSCQQNYSP-------------CGNGQC-----CK 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eaterNP_651533.3 None
abu-4NP_872210.1 DUF1096 21..71 CDD:284022 19/67 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.