DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eater and NimB5

DIOPT Version :9

Sequence 1:NP_651533.3 Gene:eater / 43262 FlyBaseID:FBgn0243514 Length:1074 Species:Drosophila melanogaster
Sequence 2:NP_001188802.1 Gene:NimB5 / 34815 FlyBaseID:FBgn0028936 Length:315 Species:Drosophila melanogaster


Alignment Length:229 Identity:82/229 - (35%)
Similarity:106/229 - (46%) Gaps:31/229 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   704 DAPEKCSCNDGYEMDSENRCS--PVCSGGCKNGFCVAPGKCSCDEGYSKET---GNSCKPICSKG 763
            |..||.|.....:.|..||.|  .||              |:   |||...   ...|:..|  |
  Fly   105 DTVEKYSYPSVIQTDQANRLSLIEVC--------------CT---GYSASRLMGVTVCRAQC--G 150

  Fly   764 CENGFCEAPEKCSCNDGYEMDGENRCSPVCSGGCKNGFCIAPGKCSCDEGYS-RETGNSCKPICS 827
            |:||.|:.|.:|.|.||:..:....|...|..||:||.|...|.|.||.||. .||...|:||||
  Fly   151 CQNGSCKIPGECECYDGFVRNDNGDCVFACPLGCQNGQCYLDGSCQCDPGYKLDETRRFCRPICS 215

  Fly   828 KGCENG---FCDAPEKCSCNDGYEMDSENRCSPVCSGGCK-NGFCVAPGKCSCDEGYSKETEISC 888
            .||.:.   .|..||.|.|:.||:: :::.|.|||...|. .|.|....:|.|..||:....: |
  Fly   216 SGCGSSPRHNCTEPEICGCSKGYQL-TDDGCQPVCEPDCGIGGLCKDNNQCDCAPGYNLRDGV-C 278

  Fly   889 APFCKDGCVNGLCVSPDFCKCDDGYIFVEESKSC 922
            ...|...|.||:|||.:.|.||.||.:.|:|..|
  Fly   279 QADCYQKCNNGVCVSRNRCLCDPGYTYHEQSTMC 312



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D16493at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24047
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.