DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eater and NimB4

DIOPT Version :9

Sequence 1:NP_651533.3 Gene:eater / 43262 FlyBaseID:FBgn0243514 Length:1074 Species:Drosophila melanogaster
Sequence 2:NP_788046.1 Gene:NimB4 / 34814 FlyBaseID:FBgn0028542 Length:448 Species:Drosophila melanogaster


Alignment Length:382 Identity:125/382 - (32%)
Similarity:161/382 - (42%) Gaps:79/382 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   541 PEKCSCDE-----GYSKETGNSCKPICSNGCENGFCDAPEKCSCND--GYEMDGENRCSPVCSGG 598
            |:||..:.     .|.||.     .|..|...|.:.:..|.| |..  .||.|. ::|.|.|...
  Fly    89 PDKCRQEVPAVFFQYDKEV-----KIVGNSSTNPYMNVIEVC-CKGWRRYEYDW-SQCVPDCGER 146

  Fly   599 C-KNGFCVAPGKCSCDEGYSKETGNSCKPICSKGCENGFCDAPEKCSCNDGYEMDSENR-CSPVC 661
            | :||||||.|||.|...:.....|:|.|.|..||.:|.|.....|.|:.|||:|...: |.|.|
  Fly   147 CQENGFCVAGGKCVCFTDFVLNYRNNCVPTCPLGCPHGRCYLNGTCQCDKGYELDGSRKFCQPQC 211

  Fly   662 SGGC-KNGFCIAPGKCSCDEGYSKETGNSCKPICSKGCENGFCDAPEKCSCNDGYEMDSENRCSP 725
            :..| .|..|:.||||||.|||::                             |....:...|.|
  Fly   212 NATCGHNEVCLEPGKCSCAEGYTR-----------------------------GLRESAALGCQP 247

  Fly   726 VCSGGCKNGFCVAPGKCSCDEGYSK-ETGNSCKPICSKGCENGFCEAPEKCSCNDGYEMD-GENR 788
            :|...|..|.||.|.:|.|..|:.| :.|.:|:..|...||||||.....|.|.:||..| ....
  Fly   248 ICIPDCGYGHCVRPNECECFPGFQKRKNGITCEGDCYMTCENGFCANKTTCVCQNGYRYDKNTTT 312

  Fly   789 CSPVCSGGCKNGFCIAPGKCSCDEGYSRETGNSCKPICSKGCENGF---CDAPEKCSCN--DGYE 848
            |.|.|...|.||.||:||.|.|.:||.|.. ..|:.:|..||  ||   |.||..|.|.  .|.|
  Fly   313 CLPDCGDNCDNGVCISPGNCRCFKGYVRNR-ERCEAVCVGGC--GFYGKCIAPNVCGCAIVPGPE 374

  Fly   849 MDSENRCSPVCSGGCKNGFCVAPGKCSCDEGYSKETEISCAPFCKDGCVNGLCVSPD 905
            ...:.         |:.|.|.|.|:|.|..|.::..:              .|:|||
  Fly   375 RTYQR---------CEYGLCNAMGRCRCQVGMTRFID--------------RCMSPD 408



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D16493at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24047
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.