DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eater and NimB1

DIOPT Version :9

Sequence 1:NP_651533.3 Gene:eater / 43262 FlyBaseID:FBgn0243514 Length:1074 Species:Drosophila melanogaster
Sequence 2:NP_001260452.1 Gene:NimB1 / 34813 FlyBaseID:FBgn0027929 Length:403 Species:Drosophila melanogaster


Alignment Length:387 Identity:120/387 - (31%)
Similarity:149/387 - (38%) Gaps:123/387 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   217 CNKFYEKDIDGN-CVPICE----NGCVNGNCTAPDVCQCLTGYTKIGHNVCLAVCPEGCQNGVCV 276
            |...|.:|...| |||.|.    :.|.||.|.:|.||:|...:.:..|..|:..||..||:|.|.
  Fly    91 CCAGYRRDPYANECVPDCSASSPDNCRNGFCRSPGVCECFAEFVRNEHGACIHTCPIACQHGRCY 155

  Fly   277 APNECSCNAGYTKLEGVCTPVCKDGCVNGFCASPEKCSCNDGYEMDSENR--CSPVCSGGC-KNG 338
                                      :||.|.      |:..:.:|.|.|  |.|.||..| .:.
  Fly   156 --------------------------LNGTCV------CHQNFVLDQETRQFCRPKCSQSCGTHE 188

  Fly   339 FCVAPGKCSCDEGYIKGTGNSCKPICSKGCENGFCDAPEKCSCNDGYEMDGENRCSPVCSGGCKN 403
            .|||||:|.|..||.:.....|:|:|:..|  ||                               
  Fly   189 ECVAPGQCDCSPGYRRTPDLGCQPVCAPDC--GF------------------------------- 220

  Fly   404 GFCVAPGKCSCDEGYSKETG-NSCKPICSKGCENGFCDAPEKCSCNDGYEMD-SENRCSPVCSGG 466
            |.||||.:|.|..|:.|... |.|:..|...||||.|::..||.|.:||..| :...|.|.||..
  Fly   221 GKCVAPNQCECFAGFIKRPNWNVCEAECYLNCENGLCESRYKCHCREGYRYDVNTTSCLPECSDN 285

  Fly   467 C--KNGFCVAPGKCSCDEGYSKETGNSCKPICSKGCENGFCDAPEKCSCNDGYEMDGENRCSPVC 529
            |  .||.|:|||.|.|..||... |..|:|    .||:.||.                       
  Fly   286 CGQGNGVCIAPGVCRCFRGYEVH-GAECRP----KCESRFCG----------------------- 322

  Fly   530 SGGCKNGFCVAPEKCSCDEGYSKETGNSCKPICSNGCENGFCDAPEKCSCNDGYEMDGENRC 591
                |.|.|||||.|.|.||             ...|.||.||..|.|||..| |....:||
  Fly   323 ----KYGRCVAPEICGCGEG-------------QQHCRNGSCDDIEHCSCPSG-ETHFIDRC 366



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D16493at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24047
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.