DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eater and NimA

DIOPT Version :9

Sequence 1:NP_651533.3 Gene:eater / 43262 FlyBaseID:FBgn0243514 Length:1074 Species:Drosophila melanogaster
Sequence 2:NP_001285918.1 Gene:NimA / 318930 FlyBaseID:FBgn0261514 Length:565 Species:Drosophila melanogaster


Alignment Length:237 Identity:59/237 - (24%)
Similarity:82/237 - (34%) Gaps:93/237 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   353 IKGTGNSC---------------KPI---CSKGCENGFCDAPEKCS------------------- 380
            |:|.||.|               :|:   .|..|    .:.|.:|:                   
  Fly    47 IQGPGNICIREEPYVEHVQVPEMQPVRVRTSSWC----MEIPPRCATFKTEMREVMRVQKLNKTR 107

  Fly   381 ----CNDGYE---MDGENRCSPVCSGGCKNGFCVAPGKCSCDEGYSKETGNSCKPICSKGCENGF 438
                |..|||   .|.:..|.|:|.|||..|.||.|..|||:|||   .|..|...|.       
  Fly   108 TVRFCCQGYEGNLSDSQATCKPICRGGCGRGSCVMPDICSCEEGY---IGKHCTQRCD------- 162

  Fly   439 CDAPEKCSCNDGYEMDSENRCSPVCSGG--CKNGFCVAPGKCSCDEGYSKETGNSCKPICSKGCE 501
                     :|.:.:|.:|.|.  |..|  |.|    ..|.|.|..|:   ||..|:..|.:|..
  Fly   163 ---------HDRWGLDCKNLCQ--CQNGAACDN----KSGLCHCIAGW---TGQFCELPCPQGTY 209

  Fly   502 NGFCDAPEKCSCNDGYEMDGENRCSPVCSGGCKNGFCVAPEK 543
            ...|  .:.|.|:       |..|:|      :.|.|:..::
  Fly   210 GIMC--RKACDCD-------EKPCNP------QTGACIQQDQ 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eaterNP_651533.3 None
NimANP_001285918.1 EMI 52..116 CDD:284877 8/67 (12%)
EGF_2 170..200 CDD:285248 12/38 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.