DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eater and dkk1b

DIOPT Version :9

Sequence 1:NP_651533.3 Gene:eater / 43262 FlyBaseID:FBgn0243514 Length:1074 Species:Drosophila melanogaster
Sequence 2:NP_571078.1 Gene:dkk1b / 30197 ZFINID:ZDB-GENE-990708-5 Length:241 Species:Danio rerio


Alignment Length:234 Identity:53/234 - (22%)
Similarity:83/234 - (35%) Gaps:71/234 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 CIPQCASGCPNGTCITPNNCSCNKGYKLNPTTQVCLPTCKDNCAAVNGFCAAPNR---CECNPGF 185
            ||....|...|...|...:.:....:.::|:..|      ....::|.....|.:   ||.:.  
Zfish    17 CIKVAGSTMLNSNAIKVGSGAAGSSHPVSPSPDV------SPLDSLNFALDTPQQPLICESDE-- 73

  Fly   186 IPKPKSKSFEC--QPKCKNGCSNGVCRAPDKCECNKFYEKDI-DGNCVPICENGCVNGNC--TAP 245
                     ||  :..|..  |.|||     .:|.|..::.| |..|.|  .|.|.||.|  ..|
Zfish    74 ---------ECGGEEFCFQ--SRGVC-----LQCKKRRKRCIRDAMCCP--GNHCSNGVCIPNDP 120

  Fly   246 DVCQCL--TGYTKIGHNVCLAVCP-------------EGCQNGVCVAPNECS---CNAG--YTKL 290
            |:.|.|  ..:..|.|....|:.|             :|.:...|:..::|:   |.|.  ::| 
Zfish   121 DIIQQLGMEEFVSIAHENSTALMPKVSTQGSPQNQMLKGLEGENCLRSSDCAETLCCARHFWSK- 184

  Fly   291 EGVCTPVCKDGCVNGFCASP-----------EKCSCNDG 318
              :|.||.|:|.|   |...           ::|.|.:|
Zfish   185 --ICKPVLKEGQV---CTKHKRKGTHGLEIFQRCDCGEG 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eaterNP_651533.3 None
dkk1bNP_571078.1 Dickkopf_N 69..116 CDD:282549 19/66 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.