DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eater and Dkk2

DIOPT Version :9

Sequence 1:NP_651533.3 Gene:eater / 43262 FlyBaseID:FBgn0243514 Length:1074 Species:Drosophila melanogaster
Sequence 2:NP_001099942.1 Gene:Dkk2 / 295445 RGDID:1308639 Length:259 Species:Rattus norvegicus


Alignment Length:206 Identity:50/206 - (24%)
Similarity:70/206 - (33%) Gaps:55/206 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   597 GGCKNGFCVAPG-KCSCDEGYSKETGNSCKPICSKGCENG-FCDAPEKCSCNDGYEMDSENRC-- 657
            ||.|.|..:... .||.|                |.||.| :|.:|.:.|.........:.||  
  Rat    64 GGSKKGKSLGQAYPCSSD----------------KECEVGRYCHSPHQGSSACMVCRRKKKRCHR 112

  Fly   658 SPVCSGG--CKNGFCI-------APGKCSCDEGYSKETGNSCKPICSKGCENGFCDAP-EKCSCN 712
            ..:|..|  |.||.||       .|...:.|....::..:........|.:|  ...| .|....
  Rat   113 DGMCCPGTRCNNGICIPVTESILTPHIPALDGTRHRDRNHGHYSNHDLGWQN--LGRPHSKMPHI 175

  Fly   713 DGYEMDSENRCSPVCSGGCKNGFCVAPGKCSCDEGYSKETGNSCKP------ICSKGCENGF--C 769
            .|:|.|...|     |..|.:|||.|      ...::|    .|||      :|:|..:.|.  .
  Rat   176 KGHEGDPCLR-----SSDCIDGFCCA------RHFWTK----ICKPVLHQGEVCTKQRKKGSHGL 225

  Fly   770 EAPEKCSCNDG 780
            |..::|.|..|
  Rat   226 EIFQRCDCAKG 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eaterNP_651533.3 None
Dkk2NP_001099942.1 Dickkopf_N 78..128 CDD:398399 17/65 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.